KEGG   Aminobacterium colombiense: Amico_0526Help
Entry
Amico_0526        CDS       T01202                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aco  Aminobacterium colombiense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amico_0526
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amico_0526
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amico_0526
Enzymes [BR:aco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amico_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(554204..555382)
Genome map
AA seq 392 aa AA seqDB search
MIQKNRKGYFGEYGGSFVPEALQVRLDELEEAYEEAKKDPSFSNEFITVLKEYVGRPSAL
TECKNISRHFGGGRLFLKREDLNHTGAHKINNALGQALLARRMGKNELIAETGAGMHGTA
SATVAALMGMKCTVYMGAVDVARQAPNVARMKVLGTEIVAVQDGQKTLKEAVDAALKAFA
EQPDTFYLLGSAVGPHPYPTMVRDFQSIIGKEARSQFLEREQKLPDYAIACVGGGSNAIG
LFSGFLDDSEVKIIGVEPAGKGLATGEHAATLSVGQPNIIHGFKSYVLSKENGEPAEVYS
ISAGLDYPGVGPEHAYLKDIGRVDYKSVTDEEAIDAFKLLSNKEGIIPALESSHALAYAF
KLLPALAKDQTVLVNLSGRGDKDMDTVLPLLV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatacagaaaaacagaaaaggatattttggagagtacggcggcagtttcgttccggaa
gcacttcaagtacgccttgatgagcttgaggaagcatatgaagaggcaaaaaaagatcct
tcgttcagcaatgaattcattactgttctaaaggagtatgtggggaggccatcggcctta
acagagtgtaagaatatctcccgtcactttggaggaggccgtctgtttcttaaacgtgaa
gatctaaatcatacaggggcccataaaatcaacaatgccttaggacaggctcttctagct
cgccgcatgggtaaaaatgaactcatagcagaaacaggggctggaatgcatggcaccgcc
agtgccacagtggcagcccttatgggaatgaaatgcacagtctatatgggagccgtcgat
gtagcaagacaggcaccaaatgtggcacgaatgaaagttctcggaactgaaatagttgcc
gtgcaggatggacaaaagactctgaaagaagcagtagacgctgcattaaaagcctttgca
gaacagcctgatactttttatctgctcggttcggcagtgggaccccatccctaccccact
atggtccgtgattttcaaagtatcataggcaaagaagctcgctctcaattcttagagcgg
gaacaaaaactcccggattacgccattgcctgtgttggcggaggaagcaacgccatcggg
cttttcagtggattcctggatgactctgaagttaaaatcataggagtggaacctgctggg
aaaggccttgctaccggagaacatgccgcaactctttctgttggtcagccaaacattatc
catggttttaaaagctacgtcctttcaaaagaaaacggggaaccagccgaagtttattcc
atatcggcaggccttgattatccaggggtcggaccggagcatgcctatcttaaggatatt
ggacgggtagactataaatctgtgacagatgaagaagctatcgatgctttcaaactcctc
agcaataaggaaggaattattcctgccctagaaagctctcatgcccttgcctatgcattt
aaacttcttcctgcattggcgaaagaccagaccgtgcttgtaaacctttctggacgggga
gataaagatatggatactgtactacctcttttagtgtga

DBGET integrated database retrieval system