KEGG   Aminobacterium colombiense: Amico_0740Help
Entry
Amico_0740        CDS       T01202                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aco  Aminobacterium colombiense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amico_0740
   00052 Galactose metabolism
    Amico_0740
   00500 Starch and sucrose metabolism
    Amico_0740
   00520 Amino sugar and nucleotide sugar metabolism
    Amico_0740
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amico_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759874..760758
Genome map
AA seq 294 aa AA seqDB search
MQKQIVSKCLFPVAGLGTRFLPATKDVPKEMLPLVNRPILSYGVEEAIDAGCTEMVMISS
RSKRSIEDYFDRTWDLEKTLAERGKKELLNLIRQIPQMARFIFTRQAEPLGLGHAVLCGE
SLCGGDYFGVILPDDVMIAQPSVLAQLIEVHESLGGSVIALETVSDEDTSRYGIVEAERI
HARVFQVHNLVEKPVKGCAPSNLAIMGRYVLSPRIFSILKEVKPGAGGEIQLTDGLIQLA
KEEPLWGVVYKGRRLDCGTQKGWLQANVELALKDPSLRDIVLQVVEEYKKGEGK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcagatagtttctaaatgccttttcccagttgcagggttaggaacccgcttt
cttcctgccacgaaagacgttcctaaagaaatgctgcccctcgttaacaggcctatcctt
tcctatggggtggaagaagcaatagatgcgggctgtactgaaatggtcatgatttcaagt
cgatccaaacgttccatcgaagattattttgatcgaacttgggacttggaaaagacactg
gcagagcgaggtaaaaaggaacttttaaatcttattcgccaaattccccaaatggcccgc
tttatatttacgcggcaggccgaacctttggggcttggccatgcagtcctctgcggggaa
tctctatgcggtggtgactattttggcgttattcttcctgatgatgtaatgattgctcag
ccctcagtgctggctcaattaatagaggtacatgaaagtttgggaggtagtgttattgcc
ttagagacggtttcagatgaagacacctcccggtatggaatagttgaagctgagagaatt
catgcaagggtctttcaagttcacaatctggtagaaaaaccggtaaaggggtgcgctccc
agtaatttggctataatgggacgatatgtcctctctcctcgaatcttctccattcttaaa
gaggtaaaaccaggggcagggggagaaatacagctcaccgatggtcttatccagttagca
aaggaagagcctttatggggtgttgtttataaaggaaggagactggattgtggtacgcaa
aagggatggttgcaggcaaatgttgaattggccctgaaagatccgtctttacgtgatata
gtactgcaagttgtagaagagtataaaaagggggaaggtaaataa

DBGET integrated database retrieval system