KEGG   Aminobacterium colombiense: Amico_0836Help
Entry
Amico_0836        CDS       T01202                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aco  Aminobacterium colombiense
Pathway
aco00010  Glycolysis / Gluconeogenesis
aco00051  Fructose and mannose metabolism
aco00562  Inositol phosphate metabolism
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
aco01200  Carbon metabolism
aco01230  Biosynthesis of amino acids
Module
aco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aco_M00002  Glycolysis, core module involving three-carbon compounds
aco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_0836
   00051 Fructose and mannose metabolism
    Amico_0836
   00562 Inositol phosphate metabolism
    Amico_0836
Enzymes [BR:aco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amico_0836
Exosome [BR:aco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amico_0836
  Exosomal proteins of bladder cancer cells
   Amico_0836
  Exosomal proteins of melanoma cells
   Amico_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE56969
JGI: Amico_0836
UniProt: D5EEI7
Position
875458..876270
Genome map
AA seq 270 aa AA seqDB search
MKKIFLFGNWKMNNGLEETKIFFKDLTAQICEDAVICDQLERSFLEVCIFPPFTSLYVGA
EILAQNVKKGIFLGGQNGFYEDKGAFTGEISLPMLKETGCSHVLIGHSERRHIMGETDDL
IHKKLQAALHHGLTPVLCFGETLSERESDLTFEVIERQILKAVNGLTKEEIKKTIWAYEP
VWAIGTGRTASPENAEEACSYARTLLCNYGNIDIEGEGHRDVHILYGGSVKAANVASLLE
EPDIDGALIGGASITADSMLEIIHESLHRG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagatatttctttttggaaactggaaaatgaacaacggcctggaagaaacgaaa
atattctttaaagatctcaccgcgcagatatgtgaggacgcagtcatttgtgaccagctg
gaaagaagttttttagaggtttgtattttcccaccttttacttcactgtatgtaggcgca
gaaattcttgctcaaaacgttaaaaaagggatttttctcgggggacaaaatggcttttat
gaagataaaggggcgtttactggcgaaatttcactcccaatgcttaaagaaacgggatgt
agtcatgtcctcattggccacagtgagcgaaggcacataatgggtgaaacagacgacctt
attcataaaaaattgcaggcggctctccatcatggtttaacacctgttctttgttttgga
gagactctttcggagagggagtccgatttaacctttgaagtaatagagcggcaaattctt
aaggccgtcaatggccttacaaaagaagagatcaaaaaaacaatttgggcatacgaacct
gtttgggccataggcacaggccgtacagccagccctgaaaatgcagaagaagcatgttcc
tatgcccgcacacttttatgtaattacggtaatatagacattgaaggggagggacatcga
gacgtccatatactttatggcggcagtgtaaaagcagcaaatgttgcgagccttcttgaa
gaacctgatattgatggagcccttattggcggagcgtccattacagcagactctatgctt
gaaattattcacgaatcacttcatagaggataa

DBGET integrated database retrieval system