KEGG   Aminobacterium colombiense: Amico_0836Help
Entry
Amico_0836        CDS       T01202                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aco  Aminobacterium colombiense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amico_0836
   01230 Biosynthesis of amino acids
    Amico_0836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_0836
   00051 Fructose and mannose metabolism
    Amico_0836
   00562 Inositol phosphate metabolism
    Amico_0836
Enzymes [BR:aco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amico_0836
Exosome [BR:aco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amico_0836
  Exosomal proteins of bladder cancer cells
   Amico_0836
  Exosomal proteins of melanoma cells
   Amico_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
875458..876270
Genome map
AA seq 270 aa AA seqDB search
MKKIFLFGNWKMNNGLEETKIFFKDLTAQICEDAVICDQLERSFLEVCIFPPFTSLYVGA
EILAQNVKKGIFLGGQNGFYEDKGAFTGEISLPMLKETGCSHVLIGHSERRHIMGETDDL
IHKKLQAALHHGLTPVLCFGETLSERESDLTFEVIERQILKAVNGLTKEEIKKTIWAYEP
VWAIGTGRTASPENAEEACSYARTLLCNYGNIDIEGEGHRDVHILYGGSVKAANVASLLE
EPDIDGALIGGASITADSMLEIIHESLHRG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagatatttctttttggaaactggaaaatgaacaacggcctggaagaaacgaaa
atattctttaaagatctcaccgcgcagatatgtgaggacgcagtcatttgtgaccagctg
gaaagaagttttttagaggtttgtattttcccaccttttacttcactgtatgtaggcgca
gaaattcttgctcaaaacgttaaaaaagggatttttctcgggggacaaaatggcttttat
gaagataaaggggcgtttactggcgaaatttcactcccaatgcttaaagaaacgggatgt
agtcatgtcctcattggccacagtgagcgaaggcacataatgggtgaaacagacgacctt
attcataaaaaattgcaggcggctctccatcatggtttaacacctgttctttgttttgga
gagactctttcggagagggagtccgatttaacctttgaagtaatagagcggcaaattctt
aaggccgtcaatggccttacaaaagaagagatcaaaaaaacaatttgggcatacgaacct
gtttgggccataggcacaggccgtacagccagccctgaaaatgcagaagaagcatgttcc
tatgcccgcacacttttatgtaattacggtaatatagacattgaaggggagggacatcga
gacgtccatatactttatggcggcagtgtaaaagcagcaaatgttgcgagccttcttgaa
gaacctgatattgatggagcccttattggcggagcgtccattacagcagactctatgctt
gaaattattcacgaatcacttcatagaggataa

DBGET integrated database retrieval system