KEGG   Aminobacterium colombiense: Amico_0978Help
Entry
Amico_0978        CDS       T01202                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
aco  Aminobacterium colombiense
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aco00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Amico_0978
Enzymes [BR:aco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Amico_0978
Amino acid related enzymes [BR:aco01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Amico_0978
Transfer RNA biogenesis [BR:aco03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Amico_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1016532..1017941)
Genome map
AA seq 469 aa AA seqDB search
MIRTRFAPSPTGLLHIGGARTALFNWLFAKKNRGQFILRIEDTDQERSRHEYAEMLNEDL
TWLGLCSDENPWSGGSYGPYTQSQRFEYYEHYLKILKEKGAIYPCFCTPEQLAEDRRQQL
EKSKPPRYEGRCRFLSTEEIGEKIAKGERPCWRFAVPESGFFVLSDLIHGDISFDYAEIG
DFVVQRSDNWPTYLFTAALDDALMHITHVIRGDEHIKNAVLQILIQKALGLPSPFFGHVP
MIVSMDRQKLSKRTGADAIREFREKGYLPEALIAYLSTLSWAPDSSVNLLDKEEIIMAFS
LERIASSSPVHDETHLDHWQSQALRARGPQWLLEEFIKLDSSITAKILAMNLRFLHLLLE
DISGACLTVLEVLESSKWLFDSPDLSEVKENLSPEWKPEIIEILRQTQEWEPAILDKTLR
SWQKGKKLKGKEFFHPLRLLLSGEEKGPAIPLEMAALGRSETLRRLERA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcacacgttttgctccctcgccaacgggattgctccacattgggggagcacgg
acagctctttttaattggctgtttgctaaaaaaaacagagggcaatttattctgagaata
gaagatactgatcaggaacgatcaaggcacgaatacgctgaaatgctcaatgaagatctt
acgtggcttggcctttgttctgatgaaaacccgtggtccggcggttcctatggcccctat
actcaaagtcaacgctttgaatattacgagcactatttaaaaatacttaaagaaaaaggg
gctatatatccctgtttctgtactcctgaacagctggcggaagatcgtcggcaacagttg
gagaaaagcaaaccccctcgctatgaagggcgttgccgcttcctttccaccgaagaaatc
ggcgaaaaaatagctaagggcgaacgtccctgctggcggtttgcagtgccggaatcagga
ttctttgtattgagtgaccttatccatggggacatttcttttgattatgcagaaatcggt
gattttgtagttcagcgatctgataattggcctacctatctttttactgcagctctggac
gacgcccttatgcatattacccatgtaattcgcggtgacgagcatattaaaaatgctgta
ctgcaaattcttatacaaaaagccctgggtttaccttccccttttttcggccatgttcca
atgatagtgagcatggatagacaaaaattaagtaagcggacgggagcggacgctattagg
gaatttagggagaaaggatatttgccagaagctctcatagcatatctctctactttaagc
tgggcgccggattcatccgtcaatcttttggacaaggaagaaatcatcatggcgttttct
cttgaaagaatagcctcatcgtcgcctgtccacgatgaaacacatctagaccactggcaa
tcacaggctttgagggcaagagggccacaatggcttcttgaagaatttataaagctagac
tcatcaataacagctaagattctcgcaatgaacctccggtttttacatttattactcgaa
gatatttcgggggcttgccttacagtccttgaagttttagaatcttccaaatggcttttt
gactctcctgatttgagcgaagtaaaagaaaatttatcaccagagtggaagcctgaaatt
attgagatacttcgccagacacaagaatgggaacctgccattcttgacaagactctccga
agttggcaaaagggaaaaaagctgaaggggaaggagttttttcatccattgagacttctt
ctgtcgggagaagaaaaagggccggcaattcctttggaaatggcggcattagggagatca
gaaactcttcgacggcttgaaagagcatag

DBGET integrated database retrieval system