KEGG   Aminobacterium colombiense: Amico_1084Help
Entry
Amico_1084        CDS       T01202                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aco  Aminobacterium colombiense
Pathway
aco00230  Purine metabolism
aco01100  Metabolic pathways
Module
aco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Amico_1084
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Amico_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 CoaE dNK AAA_17 AAA_16 Thymidylate_kin NTPase_1 MMR_HSR1 ABC_tran AAA_28 AAA_22 Methyltransf_12 Cytidylate_kin AAA Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: ADE57208
JGI: Amico_1084
UniProt: D5EF76
Position
complement(1122839..1123396)
Genome map
AA seq 185 aa AA seqDB search
MFVISGPSGAGKGTVRKALFEQMPDLVYSISCTTRQPRDGERDGVDYRFLSEEEFKKLVE
EKKFLEWAVVHEHLYGTLKSDVEKVLEAGVDVVLEIDVQGALQVKNAFDDSVLIFIMPPS
KEELERRLRNRGTEEEDTVQLRLSNALKEMEKMHMYDYVVVNDSVLRAALEIKRIIASYN
LECCL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtaatttccggcccaagtggcgcaggaaaggggacagtgagaaaagctcttttc
gaacagatgccagatctcgtatattctatttcatgcaccacccgccaaccaagggacggg
gagagggatggtgtggattatcgttttttgagtgaagaagaatttaaaaaattggtcgaa
gagaaaaaatttcttgaatgggcagttgttcatgagcatttgtacgggactctaaagtct
gacgtggaaaaagttcttgaggctggagtcgatgttgttttggagatagatgtgcaaggg
gctcttcaggtaaaaaatgcttttgatgactcagtgcttatatttatcatgcccccatct
aaagaggagctggaacggaggcttcgcaacagagggactgaagaagaggatacagtgcag
cttcgtctgagcaatgcccttaaagaaatggaaaaaatgcatatgtatgattatgttgta
gtaaatgattctgttcttcgcgcggccctggaaataaaacgtattattgcaagttacaac
cttgagtgctgtttatag

DBGET integrated database retrieval system