KEGG   Aminobacterium colombiense: Amico_1154Help
Entry
Amico_1154        CDS       T01202                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aco  Aminobacterium colombiense
Pathway
aco00900  Terpenoid backbone biosynthesis
aco01100  Metabolic pathways
aco01110  Biosynthesis of secondary metabolites
aco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Amico_1154
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Amico_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADE57277
JGI: Amico_1154
UniProt: D5EFE5
Position
complement(1171365..1172240)
Genome map
AA seq 291 aa AA seqDB search
MQYTLSSDGKLNLTLRITEKRGDGYHNLVSLFLRLPAMESLTISTYKDNNVREIATTGHI
VIDGKNIVEKTIECLESKGWSLPGLHVALAKQIPPGTGLGAGSGNAASFLRWARLFEGSE
VTSDILEKIGSDVSFLYSRSFLSLVVGKGEKSACRGPLPPMQIVVAIPGWGVSTSLAYAG
VDAFYGVDKGGSFPCNEWTGLAEVEKIYQSLLRGENVGFLPNDFYPWLAEQHPEYEAFFN
ECESSNALGYGLSGSGSSVFALFPANGKPVKLSQFEKMEWIQQILFWSDDR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaatataccctttcttctgatgggaaattaaacctcaccttgagaattacagaaaaa
aggggagatggctatcataacctggtctccctgtttttacgtttaccggcgatggagtca
ttgacaatttctacatataaagataataatgtcagggaaattgccacaactggccatatc
gtcatagatgggaaaaatattgtagaaaagacaatagagtgtcttgaaagtaaaggatgg
agtcttcctggtttacatgttgccctcgctaagcagatcccgcctggaacagggttgggg
gctggaagcggcaatgcggcttctttcttgcgatgggctcggcttttcgaaggaagcgaa
gtgacttccgatattcttgaaaagatcggttcagatgtttccttcctttacagcagatct
ttcctttcccttgttgtgggaaaaggagaaaaatcagcttgcagagggccgttgccgccc
atgcagatagttgtcgccatccctgggtggggggtgtctacgtcccttgcctacgcaggt
gtagatgccttttacggagtggataaggggggcagtttcccctgtaatgagtggactggc
ctggcagaggtggaaaaaatctaccaaagtcttctgaggggagaaaatgtagggtttcta
cccaatgatttttatccttggctggcggaacaacatcctgaatatgaagctttttttaat
gaatgtgagagttccaatgcattgggctatgggttgtctggcagcggaagcagtgttttc
gccttgttcccggcaaatggtaaaccggttaagctctcacaatttgaaaagatggaatgg
atccaacaaatcttattttggagtgatgatcgttga

DBGET integrated database retrieval system