KEGG   Aminobacterium colombiense: Amico_1313Help
Entry
Amico_1313        CDS       T01202                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
aco  Aminobacterium colombiense
Pathway
aco00010  Glycolysis / Gluconeogenesis
aco00020  Citrate cycle (TCA cycle)
aco00620  Pyruvate metabolism
aco00640  Propanoate metabolism
aco00650  Butanoate metabolism
aco00680  Methane metabolism
aco01100  Metabolic pathways
aco01120  Microbial metabolism in diverse environments
aco01130  Biosynthesis of antibiotics
aco01200  Carbon metabolism
Module
aco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_1313
   00020 Citrate cycle (TCA cycle)
    Amico_1313
   00620 Pyruvate metabolism
    Amico_1313
   00640 Propanoate metabolism
    Amico_1313
   00650 Butanoate metabolism
    Amico_1313
  Energy metabolism
   00680 Methane metabolism
    Amico_1313
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Amico_1313
Enzymes [BR:aco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Amico_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADE57431
JGI: Amico_1313
UniProt: D5EFU9
Position
1335569..1336141
Genome map
AA seq 190 aa AA seqDB search
MPQAIEIRWHGRGGQGAKSGSAILSEVLFGAGKFVQSFPEYGAERQGAPMKAYNRVSDQP
IRKRCGVQNPNVVAVIDPTLLDAARPTEGCDNNTIYLINTPMSPADIKKKLGLPDAVKVI
TIDATKITLEEFGQNRPNAPMLGTFAHIFTEVPIQAFVEHFAHKMAKLPEKVLSANLRAI
RRGYEEVQIG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaggccattgagatcaggtggcatggacgaggaggccagggagccaagtctggc
tcagccatactctccgaggtgttgttcggggccgggaaatttgtgcagtcctttcccgag
tacggggcggaacgccagggagcacccatgaaagcttataaccgggtgtctgaccagcct
atccgcaaacgctgcggtgtacagaatcctaacgtggtagcagtcatagacccaacattg
ctcgatgctgcccgcccaaccgaaggatgtgataataacacaatctaccttatcaacacc
cccatgtctccagctgatattaagaagaaactcggccttccagatgcagtcaaggttatc
actatcgatgcaaccaagatcaccctggaggagtttggtcaaaaccgccccaacgctcct
atgcttggaacctttgctcatatctttacagaggttcccattcaagcattcgttgaacac
ttcgcgcacaaaatggctaaattgcctgaaaaggtactatccgccaatctccgagccatc
cggaggggctatgaggaggtacagatcggatga

DBGET integrated database retrieval system