KEGG   Aminobacterium colombiense: Amico_1427Help
Entry
Amico_1427        CDS       T01202                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aco  Aminobacterium colombiense
Pathway
aco00300  Lysine biosynthesis
aco01100  Metabolic pathways
aco01120  Microbial metabolism in diverse environments
aco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Amico_1427
Enzymes [BR:aco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Amico_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADE57544
JGI: Amico_1427
UniProt: D5EG62
Position
complement(1457386..1458642)
Genome map
AA seq 418 aa AA seqDB search
MGENIVAYIDRMKNQMVESLAQLIGFPAISPHDGGIGEVEKARFIAKLLLEKGLPEAEWH
NAPDEKAPEKYRPNLIVRIPGRTKKRLWIITHMDVVPEGDSTLWNTSPFKASIKDGRIFG
RGSSDNGQELIASIFAAAALKEQNIVPEYEVCLCFVADEELGSLYGIQYLIKEGLFSSDD
LVVVPDGGNEQGDFIEVAEKSILWVQWTVTGKQVHGSRPDLGLNACRITNEFAMKLDGAL
HEAFPEKNELFSPPLSTFEPTRRLANVSNVNTIPGKEVFCLDCRILPSINVDGVLKVMEH
IAHSEEQKSGAEIDITVLQRTDSTSPTPSDALVVKLLSEAVKEVYSFAPVIGGVGGGTCA
AYFRKNGIPAVVWGQEADVAHMPNEYCEITHLVNETKVFALMMAGSKNTFDPLLPDGI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaatatagttgcctatatagacagaatgaaaaatcaaatggttgaaagtctg
gctcagcttattggcttccccgctatctctcctcatgacggagggataggagaggtggaa
aaagcgcgctttattgcgaagcttctactagaaaaaggccttccggaagcagaatggcat
aatgcccctgatgagaaggcgccagaaaagtatcgccctaatcttatagtgcgtattcca
ggcagaacaaaaaaacgcctttggatcatcacacacatggatgtggttccagagggagat
tccaccctttggaacactagccccttcaaggcttctataaaagatggccgtatatttggg
cggggcagcagtgacaatggacaagagctcatagccagtatttttgccgctgcggcattg
aaagagcagaatattgtgccggaatacgaggtatgcctctgctttgtagcggatgaagag
ctgggcagtctatacggcatacagtatcttatcaaagaagggcttttcagttcagatgac
cttgtggttgttccagatggtggaaatgaacagggagattttattgaagttgctgaaaaa
agcatcctgtgggtccaatggacagtgacagggaagcaggttcatggaagtaggcctgac
cttggccttaacgcttgccgaattaccaacgaatttgccatgaaactcgatggggccctc
cacgaagccttcccagaaaagaatgagcttttttctccccccctttccacttttgagcct
actcggcgattagctaacgtgagcaacgtaaacactattcccggcaaagaggtcttctgt
cttgattgtcgtatactgccttcgatcaatgtagatggagtgttgaaggttatggagcat
attgcccattcggaggagcagaaaagtggcgccgaaatcgacataaccgtactccagcga
accgattccacaagccccaccccatctgatgcgcttgtggttaagcttctttcagaagca
gttaaggaagtttattcttttgcgccggtgataggcggagtagggggcgggacctgtgct
gcctattttagaaaaaatggcattccggcagttgtctgggggcaagaagctgatgtggcc
catatgccaaatgaatattgtgaaattacccatctcgtgaatgagacaaaagtttttgcc
cttatgatggcaggcagtaaaaatacttttgacccgttactcccggacggcatataa

DBGET integrated database retrieval system