KEGG   Aminobacterium colombiense: Amico_1446Help
Entry
Amico_1446        CDS       T01202                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aco  Aminobacterium colombiense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amico_1446
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Amico_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1475007..1475498
Genome map
AA seq 163 aa AA seqDB search
MRLALGIGSNVGDRMNNLRKAVQLLKEKGVVIIAKSDIFETAPMGVTDQPRFLNACIVVD
TKFDLEELLSVVKSIEQEMGRVHRLRWGPREIDIDLLLLENGEVLDSSTLKVPHPEMHKR
AFVLMPLAQIAPDWIHPLLKVSVKKLAEDIHSQDETLLKISSL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctagcgctaggtattggaagcaacgtcggcgaccgaatgaataacttgaggaaa
gcagtacagcttctcaaggaaaagggcgttgtcatcattgctaaaagtgacatttttgaa
acggcgcctatgggagtgacagatcaaccccgttttttaaacgcctgtatcgttgttgat
acaaaatttgatcttgaagagttactctccgttgtaaagtctatagaacaggaaatggga
cgtgtccacagattgcgatggggaccccgggaaatagatatcgatcttttacttctggaa
aacggtgaagtgctggatagctcaacgctcaaggttccccacccggaaatgcataaaaga
gcttttgttcttatgccccttgcgcaaatagctccggattggatacatcccctgttgaag
gtttctgtaaaaaaactggcagaagatattcactcgcaagatgaaacattgctaaaaata
tccagtctgtag

DBGET integrated database retrieval system