KEGG   Aminobacterium colombiense: Amico_1481Help
Entry
Amico_1481        CDS       T01202                                 

Definition
(RefSeq) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aco  Aminobacterium colombiense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amico_1481
   01230 Biosynthesis of amino acids
    Amico_1481
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amico_1481
   00030 Pentose phosphate pathway
    Amico_1481
   00051 Fructose and mannose metabolism
    Amico_1481
   00052 Galactose metabolism
    Amico_1481
  Energy metabolism
   00680 Methane metabolism
    Amico_1481
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Amico_1481
Enzymes [BR:aco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Amico_1481
Protein phosphatases and associated proteins [BR:aco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Amico_1481
Messenger RNA biogenesis [BR:aco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Amico_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1509564..1510523)
Genome map
AA seq 319 aa AA seqDB search
MKRVAVLTSGGDAPGMNAAIRAVVRTAIYHHLEAVGVMRGFEGLIDGDFVPLNRASVGGI
IHRGGTILKTARSERFKTEAGLDRALFQLKNAAIDGLVIIGGDGSFRGGQKLYEKGVSVI
GVPGTIDNDVAGTDETIGFDTAVNTALEAVKKLRDTASSHDRLFIVEVMGREAGFIALEV
AVASGAEYLVVPELPFSLGRLCDKLHDTRARGKTHSLIIVAEGAMSAATLRSELKDTAGY
DARVTVLGYIQRGGSPTSFDAILASRMGAFAVESLLDGKKGMMVGTVAHQMSLCSLSDSW
QVNKILSPEKLELVEKLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagggttgcagtgctcacgagcggaggagacgccccaggtatgaacgcagctatc
cgggcagtggtacgaacggccatttatcaccatctcgaggcggtaggcgttatgcggggg
tttgaagggctgatcgatggcgatttcgtgcctttgaacagggcttctgtggggggaatc
atccataggggcggtacgattcttaagacagcccgaagcgaacggtttaaaacagaggct
ggattggatcgggccctgttccagttaaagaatgcggcaattgacggacttgtcattatt
ggtggagacggatcgttcagaggggggcagaaactttacgaaaaaggggtttctgtcata
ggagtgcccggtaccatcgataatgacgtggcgggcacagatgagaccataggctttgat
acggccgttaatacagctcttgaagccgttaaaaagcttcgtgatacggccagcagccat
gatcggctttttattgttgaagtaatgggacgggaagcgggctttattgcccttgaagtg
gctgttgccagcggagctgagtatcttgtggtgcccgaactgcctttcagcctggggcgc
ctctgcgacaagcttcacgatacgagggcccggggcaagacccactcccttattatagta
gcggaaggggccatgtctgcggcgacccttcgcagtgagcttaaggatacggcaggatac
gatgcaagggttacggttttgggatatattcagcgagggggcagcccaacgtcctttgac
gccattctcgcctctcgtatgggagcctttgctgttgaatcccttcttgatggcaaaaag
gggatgatggtggggactgttgcccatcagatgagtctctgttctctctccgattcatgg
caggttaacaaaatattgagtcccgaaaaattggaactcgttgagaagctgagcatataa

DBGET integrated database retrieval system