KEGG   Aminobacterium colombiense: Amico_1698Help
Entry
Amico_1698        CDS       T01202                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aco  Aminobacterium colombiense
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aco00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aco00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aco02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1741778..1743253)
Genome map
AA seq 491 aa AA seqDB search
MLRKFFSRKLAVIALALFLGLIGGVNSASAHAPRYVFYFIGDGMGAAQRQAAEYYLRAET
GVKDIKLRMNQFPVAGINTTYSADSLVTDSAAAGTALAAGYKTNNGIIAQLPDGTNVKSL
VEAAEEKGMGTGLVTTTRITHATPAVFASHNSNRDAENEIALDYLDSGVDFFAGGGYRHF
VPQNWDGGKSKRKDDLNIAEKFKGQGYHIFLTEKDTQKFRNYKPSGQEKVFAAFTYSHLP
YELDRENDHTPSLAELTAKGIEVLEKYKEGFFLMVEGGRIDHACHAHDPAGSIHDTLAFD
KALDEAYSFYQKYPDETLIVVVADHETGGFGLGFGDNYFLKMDQLFKAKVTTADVLNEGV
GKYDKDRKKFFDFIATNLGLDNLSLDEKIKIEQAMDLIDGSQKDAIATYAGYDPAAITVT
HIMSERANMFWTTYAHSGTTVPLSAIGVGAEALGGFKDNTEVARTLFSILEFKPTEVAFT
HPTSLPKVINY
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaagtttttttctcgtaaactggcagttattgctttggctttgtttttaggg
ctaattgggggagtgaatagtgcaagtgcccacgctccgcgctatgttttttattttatt
ggtgatggaatgggcgcagcacagcgccaggcggcagaatattatttgagggctgaaacc
ggagtaaaagatataaaacttaggatgaatcagttcccagtggcaggtatcaacaccacc
tattccgcagattccttggtaacagattctgcagcggccgggacagcattagcggcggga
tataagacgaataatggcattattgctcagcttccagatggcacgaatgtaaaaagtttg
gtggaggcagcggaagagaaggggatgggaacaggtcttgtaacaacaacgcgaataact
catgcgactcctgctgtttttgcttcccataactcaaatcgtgatgctgaaaatgaaata
gcccttgactatcttgatagcggagtggatttttttgctggcggaggatatcgccatttt
gttccccagaactgggatggcgggaaatcaaagagaaaagatgaccttaacattgcggaa
aagtttaaaggccaagggtatcatattttcctgacagaaaaagatactcaaaaatttaga
aactataagccaagtgggcaggaaaaagtctttgcggccttcacgtacagccatcttccc
tatgagcttgatagagagaatgatcacactccaagtttggcggaactaacggcgaaagga
attgaagtgttagaaaaatataaagaaggtttctttctaatggtagagggcggcagaata
gaccatgcctgtcacgcccatgatccggcggggtctatccacgacacgttagcattcgat
aaggcactagacgaagcgtactctttttaccaaaaatatcccgatgaaacgttgatagtt
gttgtagcagatcatgaaacaggcggttttgggcttgggtttggtgataattattttttg
aaaatggatcagctttttaaggcaaaggtcacgacggcggatgtgttaaatgagggtgtg
gggaaatatgataaagacaggaagaagttctttgattttattgctaccaaccttggttta
gataacttatcccttgatgagaaaataaaaattgaacaggcaatggatctcatagacggc
tctcagaaagatgcaattgcaacgtatgcagggtacgaccccgcggctattacagtaact
cacattatgtctgagcgggcaaatatgttctggaccacttatgcccactctgggacaacg
gtgcccctttcagccattggagttggcgctgaggctcttggcggatttaaagataataca
gaagtagcaagaaccttattctccattttggagttcaaacctactgaagtggcatttacc
catccaaccagtttgcctaaagtcattaattattaa

DBGET integrated database retrieval system