KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0141Help
Entry
A2cp1_0141        CDS       T00833                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:acp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(158138..159079)
Genome map
AA seq 313 aa AA seqDB search
MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRVSPRRGPVRCTVPGRP
ELDGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGSSDAAAVLRCLARALRV
RDGAALAALALEIGSDVPFFLGPGPAWAAGRGERLSRAEVPPLDLVLVYPADPSLAIRAG
DAYRWLDEARASGSQAPRRLGRPGRWRPTLLGNDLQAPCVARKPALQALLGLLVGAGATA
AIMSGSGPTVFGIFPGRGAARGAALAIQGRAKGGAAGVQVLLARTVRRHPRVSPWRSPRS
ASSRSTRRSSRPT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctcgtcacgctcgccccggccaaggtgaacctcgtgctccgcgtgggcccggtc
cgcgcggacggctaccacgacctccgcacgctgatggtcccgctcgacctcggcgatcgc
gtggacgtccgcgtgtcgccgcgccgcgggccggtccgctgcacggtgccgggccggccg
gagctggacggcccggagaacctggcggcgcgcgccgccgaggcgttccgccggcgcttc
ggcgtcgatcgcgcggtgtcgatccggatcgagaagcgtacgccggtgaccgccgggctg
ggcgggggctcctccgacgcggcggcggtgctccgctgcctcgcccgcgcgctgcgggtg
cgcgacggcgcggcgctcgccgcgctcgcgctcgagatcggctcggacgttccgttcttc
ctcggccccgggccggcgtgggcggcggggcgcggcgagcggctctcccgcgccgaggtg
ccgccgctcgacctcgtgctcgtgtatccggccgatccttcgctcgcgatccgggcgggc
gacgcctaccgctggctggacgaggcgcgcgccagcgggtcgcaggccccgcggcgtctg
ggccgtccggggcggtggcgtccgaccctgctggggaacgatctccaggcgccctgcgtg
gcgcgaaagcccgcgctccaggcgctgcttgggctgcttgtgggggcgggggcgacggcc
gctataatgtccggcagcgggccgaccgtcttcggaatcttcccgggccgaggcgcggcg
cgcggggcggcgttagcgatccagggcagggcgaaggggggcgcggctggcgtgcaggtc
ctccttgcgcggacggtgcgacggcatccgagggtatcgccatggagatcaccgaggtcc
gcgtcttcccggtcaacgaggagaagctcaaggcctacgtga

DBGET integrated database retrieval system