KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0179Help
Entry
A2cp1_0179        CDS       T00833                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_0179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_0179
   00052 Galactose metabolism
    A2cp1_0179
   00500 Starch and sucrose metabolism
    A2cp1_0179
   00520 Amino sugar and nucleotide sugar metabolism
    A2cp1_0179
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A2cp1_0179
   00524 Butirosin and neomycin biosynthesis
    A2cp1_0179
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A2cp1_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
196868..197830
Genome map
AA seq 320 aa AA seqDB search
MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLRERGPEAVVATVLHALGQAAGAAGI
APASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGTLLEKALGVPVRVANDLSVAAWG
EKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGELGHIKVRLPRPGFTPRRC
GCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELVEGDLARVTASVVEEAHALGDAYA
VALWDEVAELLGLSVANLVTLLNPARLILGGGVLLGAPRLADLTLRRFDEAVSRSATRGL
TVERAWLGDDAGVIGAAVLE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggggctcgcgctgggcgttgacctggggggcaccaacgcgcgcgccgcggtggtg
gaccgcgccaccggcgagatcgtggcctcgcacaaggagccgctgcgcgagcgcggaccc
gaggcggtggtcgcgaccgtcctccacgcgctcgggcaggcggccggcgccgccgggatc
gcgccggcgtccgcgggccgggtcggggtgggcgtggccgggcaggtgctcggcgccacc
ggcgtggtgatgaacgcgcccaacctgggctggcgcgacgtggcgttcggcacgctgctg
gagaaggcgctcggcgtgccggtgcgggtcgcgaacgacctgtcggtggcggcctggggc
gagaagcgcttcggcgccgcccgcggcatcgaggacgtggtgctggtgttcgtcggctcc
ggcgtgggctccggcctcatcctcggtggccggctgcacgacggcgcccagggggtggcc
ggcgagctcgggcacatcaaggtgcgcctgccgcgcccggggttcacgccgcgccgctgc
ggctgcggccagctcggctgcctcgaggcgtacacctcgggggtgaacgtggccgcgcgc
gtgcgcgaggagatcgcggccggcgccgccacccgcgtgctcgagctggtggagggcgac
ctcgcccgcgtcaccgccagcgtggtggaggaggcgcacgcgctgggcgacgcctacgcc
gtggcgctgtgggacgaggtcgcggagctgctcggcctctccgtggcgaacctggtcacg
ctgctcaaccccgcccggctcatcctggggggcggcgtgctgctgggcgcaccccgcctc
gccgacctgacgctccgccgcttcgacgaggcggtatcgcgctcggccacgcgggggctc
accgtggagcgcgcgtggctcggcgacgacgccggggtcatcggcgccgccgtgctcgag
tag

DBGET integrated database retrieval system