KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0437Help
Entry
A2cp1_0437        CDS       T00833                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_0437 (fadJ)
   01212 Fatty acid metabolism
    A2cp1_0437 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A2cp1_0437 (fadJ)
   00650 Butanoate metabolism
    A2cp1_0437 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    A2cp1_0437 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    A2cp1_0437 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A2cp1_0437 (fadJ)
   00310 Lysine degradation
    A2cp1_0437 (fadJ)
   00380 Tryptophan metabolism
    A2cp1_0437 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A2cp1_0437 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A2cp1_0437 (fadJ)
   00281 Geraniol degradation
    A2cp1_0437 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    A2cp1_0437 (fadJ)
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A2cp1_0437 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A2cp1_0437 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A2cp1_0437 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
491811..493988
Genome map
AA seq 725 aa AA seqDB search
MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAMREFAAHLDRLEKDEA
VKAVVVASGKPDVWVAGAKVELMQDAKDAAEAERLSRDGQSLFDRVERCRKPVVAAIHGA
CLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQRLPRLIGIQPALDLILAG
KTVKARKALKLGLVDEAVPPPLLRQVAQERAAALASGKLRRAPRRAAGAVARVTRAALEE
NFLGREVLFRQARKLTLAKTKGHYPAPLRALEAIEHGYAKGFEKGLEKEAELFGKLAMTP
EAHRLMEIFFATTALKKDNGVDDPAVKARPVSAVGVLGGGLMGGGIAYVTVNAGLPVRLR
ERDDAAAARGVAAVRGVLDERVKRRSIDRLERAEKLRLLTTTTAWSGLERVDVLVEAVFE
DLSLKQEMVRAFEAVNPTGIFASNTSSIPIGRIAEASRHPETVLGMHYFSPVHKMPLLEV
IVTPRTAPEATATAVALGKKQGKTVIVVRDGPGFYTSRILAPYMNEAAHLLVDGAAVEDL
DHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAFGARMAPPAALHDVVKAGRLGRKNG
KGFYTYGGKEKRVDETVYDLLPGGRRRRRVAADEIQERLVLQLVNEAIRCLGEGILRSAR
DGDVGAVFGLGFPPFRGGPFRWADAVGTKALLDRLERLRARHGERFEPAPLLAELGRAGR
PFHGG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggctgaggcgatgacggcgggccagggcgcgtcgaggtacttccgcgtggag
gtcgccggcggcgtggcgacgctggtgctcgacgagccgggcgagcgcgtgaacaccgtg
caccccgaggcgatgcgggagttcgcggcccacctcgaccggctggagaaggacgaggcg
gtgaaggccgtcgtggtcgcgagcggcaagcccgacgtgtgggtggccggcgcgaaggtc
gagctgatgcaggacgcgaaggacgccgccgaggcggagcggctgtcgcgcgacggccag
tcgctgttcgaccgggtggagcgctgccggaagccggtggtggccgccatccacggcgcc
tgcctgggcggcgggctggagtgggcgctcgcctgccactaccggatcgccaccgaccac
ccgaagacctcgctcggcctggtcgaggtgcagctcggcctcatcccgggcggcggcggg
acgcagcggctcccgcggctcatcggcatccagccggcgctcgacctcatcctcgcgggc
aagaccgtgaaggcgaggaaggcgctgaagctcggcctggtggacgaggcggtcccgccg
ccgctgctgcggcaggtggcgcaggagcgcgccgccgcgctcgcctcgggcaagctgcgc
cgcgcgccgcggcgggccgccggggcggtggcccgggtcacccgcgccgccctggaggag
aacttcctcggccgcgaggtcctgttccggcaggcgcggaagctcacgctcgcgaagacg
aaggggcactacccggcgccgctgcgcgccctcgaggccatcgagcacgggtacgcgaag
gggttcgagaaggggctggagaaggaggcggagctgttcgggaagctcgccatgacgccg
gaggcgcaccggctcatggagatcttcttcgccaccaccgcgctcaagaaggacaacggg
gtggacgatcccgccgtgaaggcgcgcccggtctccgcggtgggcgtgctcggcggcggc
ctgatgggcggcgggatcgcctacgtgaccgtgaacgccggcctgccggtgcgcctgcgc
gagcgggacgacgcggcggcggcgcgcggggtggcggcggtgcgcggcgtcctcgacgag
cgggtgaagcgccggtccatcgaccggctggagcgcgccgagaagctgcgcctgctcacc
accaccaccgcctggtccggcctggagcgggtggacgtgctcgtggaggcggtgttcgag
gacctgtccctgaagcaggagatggtgcgcgcgttcgaggcggtgaacccgaccggcatc
ttcgcgtccaacacctcgtccatccccatcggccggatcgccgaggcgtcgcgccacccc
gagaccgtgctcgggatgcactacttctcgccggtccacaagatgccgctgctcgaggtg
atcgtcacgccgcgcacggcgccggaggcgaccgccaccgcggtggcgctcggcaagaag
cagggcaagacggtgatcgtggtgcgcgacgggcccggcttctacacgagccgcatcctc
gcgccgtacatgaacgaggccgcgcacctgctggtggacggcgcggcggtcgaggacctg
gaccacgcgctggtggcgttcgggttcccggtgggccccatcacgctgctcgacgaggtc
ggcatcgacgtcggcgacaaggtcgggaagatcctgcaggaggcgttcggggcgcgcatg
gcgccgcccgcggcgctgcacgacgtggtgaaggccgggcgcctgggccgcaagaacggg
aagggcttctacacctacggcggcaaggagaagcgcgtggacgagaccgtctacgacctg
ctgcccggcggccgccgccgcaggcgcgtcgccgccgacgagatccaggagcggctggtg
ctccagctcgtcaacgaggcgatccgctgcctgggcgagggcatcctgcgctcggcgcgc
gacggcgacgtcggcgcggtgttcggcctcggcttcccgccgttccgcggcgggccgttc
cgctgggccgacgcggtgggcacgaaggcgctgctcgaccggctggagcggctccgcgcg
cggcacggcgagcgcttcgagccggcgccgctgctcgccgagctgggccgggcgggccgg
ccgttccacggcggctag

DBGET integrated database retrieval system