KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0526Help
Entry
A2cp1_0526        CDS       T00833                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A2cp1_0526
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A2cp1_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
604938..605795
Genome map
AA seq 285 aa AA seqDB search
MTSPARPPLRLAVVGHVEHVTIGRVAAVPRAGEIAHLEAPRWFPGGGGGVAFWQLARSPA
EVLLYTALGDDEAGAQVERALGAAGARVRVHAARRAEPHTRDLVLLTPDGERTIVVVGEP
LHPRADDPLPWGALAGCDAAYFTAQDPAALRAARAARLLVVTARRREALARSGVAADVVV
GSRLDAREVSARADYPMPPAALVLTEGAAGGIIETAAGVERFPAPPSPEAVGGAYGAGDS
FAGALVFFLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLPLEAP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcccgctcgccccccgctccggctcgccgtcgtcggccacgtcgagcacgtc
accatcggccgcgtggcggcggtgccgcgcgccggcgagatcgcgcacctcgaggcgccg
cgctggttcccgggcggcgggggcggggtcgcgttctggcagctcgcccgctcgccggcc
gaggtgctgctgtacaccgcgctcggcgacgacgaggccggcgcgcaggtggagcgggcg
ctcggcgcggccggcgcgcgcgtgcgcgtgcacgcggcgcgccgcgccgagccgcacacc
cgcgacctcgtcctgctcacgcccgacggcgagcggaccatcgtggtggtcggcgagccg
ctccacccgcgcgccgacgacccgctgccctggggcgcgctggccggctgcgacgccgcg
tacttcaccgcgcaggatcccgccgcgctccgcgccgcccgcgcggcgcgcctgctggtg
gtcaccgcccgccgccgcgaggcgttggcccggtccggcgtggcggccgacgtggtggtg
gggagccgcctcgacgcgcgcgaggtgagcgcgcgcgccgactacccgatgccgccggcc
gcgctggtgctcaccgagggcgcggccggtggcatcatcgagaccgccgccggggtggag
cgcttcccggcgccgccctcgcccgaggccgtcggcggcgcctacggcgcgggcgacagc
ttcgccggcgcgctcgtgttcttcctcgcggccgggctgccgctccgcgacgcctgcgcg
gcggcgggccgtcacggggcggcggtgctgcgcgcggtggacccgcgcgacggccagctc
ccgctggaggcgccgtga

DBGET integrated database retrieval system