KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0625Help
Entry
A2cp1_0625        CDS       T00833                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A2cp1_0625
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    A2cp1_0625
Enzymes [BR:acp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     A2cp1_0625
Two-component system [BR:acp02022]
 CheA family
  CheA-CheYBV
   A2cp1_0625
Bacterial motility proteins [BR:acp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    A2cp1_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(701283..702332)
Genome map
AA seq 349 aa AA seqDB search
MAPRILVVDDSAVVRMALSQILGRAGLEVETAIDPLVAMEKMRRARPDAIVLDIEMPRMD
GLTFLDRVMAQDPVPVVVCSGLAGPGSEVALHALEHGAVDVIEKPRLGVKGFLEESARRI
VEVVRAATQARLRARVRALRPLPRAPAGAQPRPAPRLAARPGRAELVVVGASTGGTEALR
VLLEAMPADAPAIAVVQHMPEVFTEQFARRLDKLCRIEVKEAADGDRLLPGRALVAPGNR
HLSVKRAGGLVAVVSDGPPVSLHRPSVDVLFHSAARVAGPGTLAILLTGMGDDGADGMVE
LRRAGAHTVAQDESTSVVFGMPKEAIARGGAVEVLPLPRIAPALLAWAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccgcgcatcctggtggtggacgactcggcggtggtccggatggcgctgtcccag
atcctgggacgggccgggctcgaggtcgagaccgccatcgacccgctggtggcgatggag
aagatgcgccgggcccgcccggacgcgatcgtcctcgacatcgagatgccgcgcatggac
gggctcacgttcctcgaccgcgtcatggcccaggatcccgtgccggtggtggtgtgctcg
ggcctggccgggccggggagcgaggtggcgctgcacgcgctggagcacggcgcggtggac
gtcatcgagaagccgcgcctcggggtgaaggggttcctggaggagtcggcgcggcggatc
gtggaggtggtccgcgccgccacgcaggcgcgcctgcgggcccgggtccgcgcgctccgc
ccgctgccccgggcaccggccggcgcccagccccgtcccgccccccggctcgcggcgcgg
cccgggcgcgccgagctggtggtggtgggcgcctcgaccggcggcaccgaggcgctgcgc
gtgctgctcgaggcgatgccggccgacgcgcccgccatcgcggtggtgcagcacatgccg
gaggtgttcaccgagcagttcgcgaggcgcctcgacaagctctgccggatcgaggtgaag
gaggccgccgacggcgatcggctgctgcccgggcgcgcgctggtggcgcccggcaaccgt
cacctctcggtgaagcgcgcgggcgggctggtggcggtggtgtccgacggcccgccggtc
tcgctgcaccggcccagcgtggacgtgctgttccactcggccgcacgggtcgcgggaccg
ggcacgctcgccatcctgctcaccggcatgggcgacgacggcgcggacgggatggtggag
ctgcgacgggccggcgcgcacacggtcgcgcaggacgagtccacctcggtggtgttcggg
atgccgaaggaggccatcgcccgcggcggggccgtcgaggtgctcccgctcccgcgcatc
gcgcccgccctgctggcctgggcgcgatag

DBGET integrated database retrieval system