KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_0834Help
Entry
A2cp1_0834        CDS       T00833                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_0834
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A2cp1_0834
  Amino acid metabolism
   00310 Lysine degradation
    A2cp1_0834
Enzymes [BR:acp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A2cp1_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
934567..935880
Genome map
AA seq 437 aa AA seqDB search
MSIQLKVPNIGESVQTATIGTWLKKEGEPVQADEPVVEVESEKATVAVPAPAAGVLRKVL
RQSGETVAIGEVIAELDEGGAAQAAGASPFGSGPVPGGTVPAARGDGAPAPAPAPAIAPV
ASAPARAAAAAPAPAAPPAAPPAPAAAAGFRASPSARRRMAELGVTAGQVEAIATGGQIR
RDDVARALEARPAAPAPAAPAVAGPRERVVAMTPLRRTVARRLVEAQHTAALLTTFNEVD
MSRVLALREQHGEAFLKRHGVKLGFMSFFVKASIEALRAYPGVNGEIRGDSIVYKDHYDV
GVAVGGGKGLVVPVIRDADALSFAEVEATIGELAKKAKENRITMEDLAGGTFTISNGGIY
GSMLSTPIINPPQSGILGLHKIQKRAVVDADDQVVVRPMMYLALSYDHRLVDGREAVSFL
VKVKECIEDPERMLLEV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccagctcaaggtcccgaacatcggcgaatccgtgcagacggccaccatcggc
acgtggctcaagaaggagggcgagccggtccaggccgacgagcccgtggtggaggtggag
agcgagaaggccaccgtggcggtcccggcgcccgccgccggcgtgctgcggaaggtgctc
cggcagtcgggcgagaccgtcgccatcggcgaggtgatcgccgagctggacgagggcggc
gccgcccaggccgcgggggcctcgccgttcggctccggcccggtgcccggcggcaccgtc
cccgccgcccgcggcgacggcgccccggcgccggccccggctcccgccatcgcacctgtc
gcttccgcaccggcccgggccgccgccgcggcgcccgcgcccgccgcgccgccggcggcc
ccgcccgcgcctgccgccgccgccgggttccgagcgtcgccctcggcgcgccgcaggatg
gccgagctgggcgtgacggccgggcaggtggaggcgatcgccaccggcggccagatccgc
agggacgacgtggcccgcgcgctcgaggcgcgcccggccgcccccgcacccgcggccccg
gccgtggctggcccgcgcgagcgcgtggtcgcgatgacccccctgcgccgcaccgtggcg
cgccggctggtcgaggcgcagcacaccgcggcgctgctcaccaccttcaacgaggtggac
atgtcgcgcgtgctcgcgctccgcgagcagcacggcgaggcgttcctgaagcgccacggc
gtgaagctcggcttcatgtcgttcttcgtgaaggcgtccatcgaggcgctgcgcgcctac
ccgggcgtgaacggcgagatccgcggcgacagcatcgtctacaaggaccactacgacgtc
ggcgtggcggtgggcggcggcaagggcctggtggtcccggtgatccgcgacgcggacgcg
ctctccttcgccgaggtcgaggcgaccatcggcgagctggcgaagaaggcgaaggagaac
cgcatcaccatggaggacctcgccggcggcacgttcaccatctcgaacggcggcatctac
ggttcgatgctctcgacgcccatcatcaacccgccgcagtcgggcatcctcggcctgcac
aagatccagaagcgcgcggtggtggacgccgacgaccaggtggtggtccgcccgatgatg
tacctggcgctctcgtacgatcaccggctggtggacggccgcgaggcggtctccttcctc
gtgaaggtgaaggagtgcatcgaggatccggagcggatgctgctggaggtctga

DBGET integrated database retrieval system