KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1010Help
Entry
A2cp1_1010        CDS       T00833                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A2cp1_1010
Enzymes [BR:acp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A2cp1_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1136667..1137260
Genome map
AA seq 197 aa AA seqDB search
MIARLAGRIAEKRDDHAIVDVGGVGYLVHLSQLSLASLPPPGEPAALRVYTHVREDALDL
YGFATEDEEAVFRALIDVKGVGPRAAQNILSGIEARELAQAVAQGDVARLTKVQGIGKKT
AERLVLELKEKLVALARAAGPARAGAEADVLEQLRTALLNLGYRPPQAEGVAEALRDSAE
GRPLDELLREALKLLRG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgcgcctggccgggcggatcgccgagaagcgcgacgaccacgccatcgtggac
gtgggcggggtcggctacctcgtgcacctctcgcagctctcgctggcctcgctcccgccg
ccgggcgagcccgccgcgctccgcgtctacacccacgtccgcgaggacgcgctcgacctg
tacggcttcgcgaccgaggacgaggaggcggtgttccgcgccctcatcgacgtgaagggg
gtggggccgcgcgcggcgcagaacatcctctccggcatcgaggcgcgcgagctggcgcag
gcggtggcgcagggcgacgtcgcccggctcaccaaggtccagggcatcgggaagaagacc
gccgagcggctggtgctggagctgaaggagaagctggtcgcgctggcgcgcgctgccggg
cccgcccgcgccggcgcggaggcggacgtgctcgagcagctccggaccgcgctgctcaac
ctcggctaccggccgccgcaggcggagggcgtggcggaggcgctgcgcgactcggccgag
ggccggccgctcgacgagctgctgcgcgaggcgctgaagctgctgcgcgggtag

DBGET integrated database retrieval system