KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1040Help
Entry
A2cp1_1040        CDS       T00833                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A2cp1_1040
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A2cp1_1040
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A2cp1_1040
Enzymes [BR:acp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A2cp1_1040
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A2cp1_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1164602..1166008)
Genome map
AA seq 468 aa AA seqDB search
MHARTLAALALALSAGDAVAAGPAKNVIFFLGDGMGPTTVTAARIFAHGEAGALAMDGLG
RTARVKTYSANAQTTDSAPSMSAYMTGVKMNNEVVSMSAETSAADLSVTPPAPYVSGADS
TCPETGNGSPVTTLLELAKAAGKAVGAVTTTRVTHATPAATYSHLCHRDGENTIAEQVTP
GHPGFNPALGAGVDVLLGGGWRHFVPSTTTGSKRSDATDLTALFTGAGYTYVTSGSALAA
VDPAATTRLLGLFNRDHLSYELDRVANGADEPSLADMTEKAIRILSRDGDGFFLMVEGGR
IDHALHGTNARRALEDTVAFDDAIARALALVDPADTLIVVTADHDHTLAFNGYAHRGNPV
LGLSTDLKQTAVTGAPVPALAADGRAYTTLVFGNGGTPRNADRADPSLVDTTAPGYLQDV
GVQLGTPGSETHGGGDVMLFAKGAGSAGFKGTIDNTRVFGLVRAAMGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacgcaccctcgcggcgctcgcgctcgcgctctccgccggcgacgccgtcgcc
gccggcccggccaagaacgtcatcttcttcctcggcgacgggatgggtcccaccaccgtg
accgccgcacgcatcttcgcgcacggcgaggccggcgccctcgccatggacggcctcggc
cgcacggcccgggtcaagacctactccgcgaacgcccagaccaccgacagcgcgccctcc
atgtcggcgtacatgaccggcgtgaagatgaacaacgaggtggtctcgatgtccgcggag
acctccgcggcggacctgtccgtcaccccgccggccccttacgtctccggcgcggactcc
acctgccccgagaccggcaacggctcgccggtgaccacgctgctcgagctcgccaaggcc
gccggcaaggcggtcggcgcggtgaccaccacccgcgtcacccacgccaccccggccgcg
acgtactcgcacctctgccaccgcgacggcgagaacaccatcgcggagcaggtgaccccg
gggcatccgggcttcaaccccgccctgggcgccggtgtggacgtgctgctcggcggcggc
tggcggcacttcgtccccagcaccaccaccggcagcaagcggtccgacgcgaccgacctc
accgcgctgttcaccggggccggctacacctacgtcaccagcggcagcgcgctcgcggcg
gtggaccccgccgcgaccacccgcctcctgggcctgttcaaccgcgatcacctgtcgtac
gagctggaccgtgtcgcgaacggcgccgacgagcccagcctcgcggacatgaccgagaag
gccatccgcatcctctccagggacggcgacggcttcttcctcatggtcgagggcggccgc
atcgaccacgcgctccacgggacgaacgcgcggcgcgcgctcgaggacacggtcgcgttc
gacgacgccatcgcgcgggcgctcgcgctcgtggaccctgccgacacgctcatcgtggtc
accgccgaccacgaccacaccctcgcgttcaacggctatgcccaccgcggcaatccggtg
ctcggcctctccaccgacctcaagcagaccgcggtgaccggcgcacccgtcccggcgctc
gccgccgacggccgggcgtacacgacgctcgtcttcggcaacggcggcacgccccggaac
gccgaccgggccgacccgagcctggtcgacaccaccgcccccggctacctgcaggacgtc
ggcgtccagctcggcaccccgggttccgagacgcacggcggcggcgacgtgatgctgttc
gcgaagggcgccgggagcgccgggttcaaggggacgatcgacaacacgcgcgtgttcggc
ctggtgcgcgcggcgatggggctgtag

DBGET integrated database retrieval system