KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1040Help
Entry
A2cp1_1040        CDS       T00833                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:acp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:acp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1164602..1166008)
Genome map
AA seq 468 aa AA seqDB search
MHARTLAALALALSAGDAVAAGPAKNVIFFLGDGMGPTTVTAARIFAHGEAGALAMDGLG
RTARVKTYSANAQTTDSAPSMSAYMTGVKMNNEVVSMSAETSAADLSVTPPAPYVSGADS
TCPETGNGSPVTTLLELAKAAGKAVGAVTTTRVTHATPAATYSHLCHRDGENTIAEQVTP
GHPGFNPALGAGVDVLLGGGWRHFVPSTTTGSKRSDATDLTALFTGAGYTYVTSGSALAA
VDPAATTRLLGLFNRDHLSYELDRVANGADEPSLADMTEKAIRILSRDGDGFFLMVEGGR
IDHALHGTNARRALEDTVAFDDAIARALALVDPADTLIVVTADHDHTLAFNGYAHRGNPV
LGLSTDLKQTAVTGAPVPALAADGRAYTTLVFGNGGTPRNADRADPSLVDTTAPGYLQDV
GVQLGTPGSETHGGGDVMLFAKGAGSAGFKGTIDNTRVFGLVRAAMGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacgcaccctcgcggcgctcgcgctcgcgctctccgccggcgacgccgtcgcc
gccggcccggccaagaacgtcatcttcttcctcggcgacgggatgggtcccaccaccgtg
accgccgcacgcatcttcgcgcacggcgaggccggcgccctcgccatggacggcctcggc
cgcacggcccgggtcaagacctactccgcgaacgcccagaccaccgacagcgcgccctcc
atgtcggcgtacatgaccggcgtgaagatgaacaacgaggtggtctcgatgtccgcggag
acctccgcggcggacctgtccgtcaccccgccggccccttacgtctccggcgcggactcc
acctgccccgagaccggcaacggctcgccggtgaccacgctgctcgagctcgccaaggcc
gccggcaaggcggtcggcgcggtgaccaccacccgcgtcacccacgccaccccggccgcg
acgtactcgcacctctgccaccgcgacggcgagaacaccatcgcggagcaggtgaccccg
gggcatccgggcttcaaccccgccctgggcgccggtgtggacgtgctgctcggcggcggc
tggcggcacttcgtccccagcaccaccaccggcagcaagcggtccgacgcgaccgacctc
accgcgctgttcaccggggccggctacacctacgtcaccagcggcagcgcgctcgcggcg
gtggaccccgccgcgaccacccgcctcctgggcctgttcaaccgcgatcacctgtcgtac
gagctggaccgtgtcgcgaacggcgccgacgagcccagcctcgcggacatgaccgagaag
gccatccgcatcctctccagggacggcgacggcttcttcctcatggtcgagggcggccgc
atcgaccacgcgctccacgggacgaacgcgcggcgcgcgctcgaggacacggtcgcgttc
gacgacgccatcgcgcgggcgctcgcgctcgtggaccctgccgacacgctcatcgtggtc
accgccgaccacgaccacaccctcgcgttcaacggctatgcccaccgcggcaatccggtg
ctcggcctctccaccgacctcaagcagaccgcggtgaccggcgcacccgtcccggcgctc
gccgccgacggccgggcgtacacgacgctcgtcttcggcaacggcggcacgccccggaac
gccgaccgggccgacccgagcctggtcgacaccaccgcccccggctacctgcaggacgtc
ggcgtccagctcggcaccccgggttccgagacgcacggcggcggcgacgtgatgctgttc
gcgaagggcgccgggagcgccgggttcaaggggacgatcgacaacacgcgcgtgttcggc
ctggtgcgcgcggcgatggggctgtag

DBGET integrated database retrieval system