KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1461Help
Entry
A2cp1_1461        CDS       T00833                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A2cp1_1461
Enzymes [BR:acp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A2cp1_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1634877..1635671
Genome map
AA seq 264 aa AA seqDB search
MPAAPARPLAGRTVVVTRGKGSEGKDALAARLEALGAEVRALPSIAFAPPADPAPLDAAL
RALDRFDWAVFTSANAVDRTVERLRALGLDPAALGRLRLAAVGPATAERLAAAVRAPDVV
PVEAKGDVLARTLGDHIRGRRVLFPRPAEGRPETVAGLLAAGAELTAVEAYRTVPAPAEA
LAHLAGWLAAGEVAAVAFASPSAVAAVLAALGDRSALLRGVLIAAIGPTTADTLREAGLP
VGAVPAHYTGRDLAEAIAERLGPG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgcgcccgcgcggccgctggccggccgcaccgtggtggtgacccggggcaag
ggctccgagggcaaggacgcgctcgcggcccggctcgaggcgctgggcgcggaggtgcgc
gcgctcccctcgatcgcgttcgctccgcccgccgatcccgcgccgctcgacgccgcgctc
cgcgcgctcgaccgcttcgactgggcggtgttcaccagcgcgaacgcggtggaccggacg
gtggagcggctgcgcgcgctcggcctcgatccggccgccctgggccggctccgcctcgcc
gccgtcgggcccgccaccgccgagcggctggcggcggcggtgcgcgcgccggacgtggtg
ccggtcgaggcgaagggagacgtgctcgcccgcaccctgggcgaccacatccgcggccgg
cgggtgctgttcccgcgcccggccgagggccggcccgagaccgtggccgggctcctcgcc
gccggggccgagctgaccgcggtcgaggcgtaccggacggtccccgcgcccgccgaggcg
ctggcgcacctggcgggctggctcgcggccggtgaggtcgcggcggtcgcgttcgcgtcc
ccctcggcggtggcggccgtgctggcggcgctcggggaccggtcggccctcctccgaggg
gtgctgatcgcggcgatcgggcccaccactgcggacacgctgcgcgaggcggggctcccg
gtgggcgccgtcccggcgcactacaccggccgagacctcgcggaggccatcgccgagcgg
ctcggccccgggtag

DBGET integrated database retrieval system