KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1503Help
Entry
A2cp1_1503        CDS       T00833                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A2cp1_1503
Enzymes [BR:acp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A2cp1_1503
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A2cp1_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1683551..1684576
Genome map
AA seq 341 aa AA seqDB search
MPFPQHRPRRMRRTEALRSLVRETTLAPQHLVWPLFVLPGTKVRNPVKSMPGVFQLSVDE
LVAEVQQGFEAGVRSVILFGIPEHKDPQGTEAYADDGIVPQAIRALKERVPGMVVMTDVC
MCEYTDHGHCGILKASKAGGPGNELQVDNDLTLPLLAKEALAHARAGADIVAPSDMMDGR
VAAIRAELDGAGYQDVPILSYAAKFAGAFYGPFRDAAESAPVEGPGIPKDRKGYQMDPAN
WREALREVELDVAEGADMIMVKPAVPYLDIVRQVRDRFDLPTAAYHVSGEYAMIKAAAER
GWIDEDRVVLETLLCCRRAGADLVLTYYAKHAAQLLSGKKR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcccccagcaccgcccccgccgcatgcgccgcaccgaggccctccggagcctg
gtgcgcgagaccaccctcgccccgcagcacctggtgtggccgctcttcgtgctccccggc
acgaaggtgcggaacccggtgaagagcatgccgggcgtgttccagctctccgtggacgag
ctggtcgccgaggtgcagcagggcttcgaggcgggcgtccgctcggtgatcctgttcggc
atccccgagcacaaggacccgcagggcaccgaggcgtacgccgacgacgggatcgtcccg
caggccatccgggcgctgaaggagcgggtgcccggcatggtggtgatgaccgacgtgtgc
atgtgcgagtacacggatcacggccactgcggcatcctcaaggcgtcgaaggccggtggc
ccgggcaacgagctgcaggtcgacaacgacctcacgctcccgctcctcgccaaggaggcg
ctcgcccacgcccgcgccggcgccgacatcgtggcgccctcggacatgatggacgggcgc
gtggcggcgatccgcgccgagctggacggcgccggctaccaggacgtgcccatcctgtcg
tacgcggcgaagttcgcgggcgcgttctacggcccgttccgcgacgccgcggagagcgcg
ccggtggagggcccgggcatccccaaggaccgcaagggctaccagatggatcccgccaac
tggcgcgaggcgctccgcgaggtggagctcgacgtcgccgagggcgcggacatgatcatg
gtgaagccggccgtgccgtacctcgacatcgtgcgccaggtgcgcgaccgcttcgacctg
cccaccgccgcgtaccacgtgtccggcgagtacgcgatgatcaaggccgccgccgagcgc
ggctggatcgacgaggaccgggtggtgctcgagacgctgctctgctgccggcgcgccggc
gcggacctcgtgctcacctactacgcgaagcacgccgcccagctcctctccgggaagaag
cgttga

DBGET integrated database retrieval system