KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1556Help
Entry
A2cp1_1556        CDS       T00833                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00910  Nitrogen metabolism
acp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    A2cp1_1556
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     A2cp1_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 DUF2415 Cu-oxidase_2 Copper-bind
Motif
Other DBs
NCBI-ProteinID: ACL64900
JGI: A2cp1_1556
UniProt: B8J545
Position
1738972..1740834
Genome map
AA seq 620 aa AA seqDB search
MADTKLWTRIAVALAAVGALALVVGCPPSKPKGSKRPAAASDIAVAAEKTYVPPGDLDEY
YMFSSGGHSGQVYVYGIPSMRHITTIPVFAPYSGTGYGFDDESKAMLGNLTWGDVHHPAL
SETGGDYDGRWLFVNEMNGRVARIDLRDFKTRQIIGPVPNISGNHGSTFITPNSEYILMS
SRFSIPIPKGKAVSIDRYASEYKGVAAGIKVDPKTGQMSLGWQVLLPPFDWDLGDAGKKL
SEGWFFLTCYNSERATGKLEVTASQRDRDYIAAIDWRLAEKAAAEGKGELVGGVKVLDPK
TVPGLVYLLPCGKSPHGVDVSPDGKYVVGSGKLQGVTTAFNFEKVLTAIKNKDFAGEEDG
IPVLKYESIKDAEVPVGLGPLHTQFGPDGMAYTSLFVDSALAKWKLGTWEVLDKVPMSYS
TGHLAAAEGDTVSPDGKWLVGLNKLSHGRHLPVGPSQPESSQLVDISGDKMKLVYDAFTE
PEPHYAQIIKADKLKPIEVYPREENKHPLAIWDVKDAGVTRKGNEVLAKVVVVRSSMTPA
LIEVNEGDTVKVALTNIEQTTDELHGFGLLDYNINVVLDPGETKTVTFKADKPGVFPYYC
TNFCSALHQEMQGYLVVKPR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaagctctggacgaggatcgccgtggcgctcgcggcggtgggggcgctg
gcgctcgtggtgggctgcccgcccagcaagccgaagggctcgaagcgccccgccgccgcg
tcggacatcgcggtggcggcggagaagacctacgtcccgcccggcgacctcgacgagtac
tacatgttctcgtccggcggtcactccgggcaggtctacgtctacggcatcccgtcgatg
cgccacatcaccaccatcccggtgttcgcgccgtactcgggcacgggctacggcttcgac
gacgagtcgaaggcgatgctcggcaacctgacctggggtgacgtgcaccacccggcgctc
tccgagaccggcggcgactacgacgggcgctggctgttcgtcaacgagatgaacgggcgg
gtggcgcgcatcgacctgcgcgacttcaagacgcggcagatcatcgggccggtgccgaac
atctcgggcaaccacgggtccaccttcatcacgccgaacagcgagtacatcctcatgtcc
tcgcggttctccatccccatccccaaggggaaggcggtgtcgatcgaccggtacgccagc
gagtacaagggcgtcgcggccgggatcaaggtcgacccgaagaccggccagatgtcgctg
ggctggcaggtgctcctgccgccgttcgactgggacctcggcgacgccggcaagaagctg
tcggagggctggttcttcctcacctgctacaactccgagcgcgccaccgggaagctcgag
gtcaccgcctcgcagcgcgaccgcgactacatcgcggccatcgactggcgcctggccgag
aaggcggcggcggaggggaagggcgagctcgtcggcggcgtgaaggtgctcgatccgaag
accgtccccgggctcgtgtacctgcttccctgcgggaagtcgccgcacggcgtggacgtc
tcgcccgacggcaagtacgtggtcggctccggcaagctccagggcgtcaccaccgccttc
aacttcgagaaggtcctcaccgccatcaagaacaaggacttcgccggcgaggaggacggc
atcccggtcctcaagtacgagtccatcaaggacgcggaggtgccggtggggctcgggcct
ctccacacgcagttcgggcccgacggcatggcgtacacctcgctgttcgtggacagcgcg
ctcgcgaagtggaagctcgggacctgggaggtcctggacaaggtcccgatgtcctactcg
accggccacctcgccgcggccgagggcgacaccgtctcgccggacgggaagtggctggtg
ggcctcaacaagctctcccacgggcggcacctccccgtcggcccgtcgcagcccgagtcc
tcgcagctcgtggacatctcgggcgacaagatgaagctcgtctacgacgcgttcaccgag
cccgagccgcactacgcgcagatcatcaaggccgacaagctgaagccgatcgaggtctac
ccgagggaggagaacaagcacccgctcgcgatctgggacgtgaaggacgcgggggtgacg
cgcaagggcaacgaggtgctggcgaaggtggtggtggtgcggtccagcatgacgccggcg
ctcatcgaggtgaacgagggcgacacggtcaaggtcgcgctcaccaacatcgagcagacc
accgacgagctccacggcttcgggctgctcgactacaacatcaacgtcgtcctcgatccc
ggcgagaccaagaccgtcaccttcaaggccgacaagccgggcgtcttcccctactactgc
accaacttctgctccgcgctgcaccaggagatgcagggttatctcgtggtgaagccgagg
tag

DBGET integrated database retrieval system