KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1726Help
Entry
A2cp1_1726        CDS       T00833                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_1726
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A2cp1_1726
Enzymes [BR:acp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A2cp1_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1925132..1927378)
Genome map
AA seq 748 aa AA seqDB search
MDFEQEVAALRRWFESPRFAGIRRIHTAREVMEQRGTIRQDYPVAREAAEAFHARLRELF
QQRRCITTFGPYSPGQAVAMKKMGIEAIYLGGWATSAKGSVQEDPGPDLASYPLSQVPDE
AAPIVRALLTADRNQHHARSRMTEEQRRATPAVDFRPFIIADADTGHGGDAQVRNLVRRF
VEVGVPGYHIEDQKPGVKKCGHQGGKVLVAEDEQLKRLSAARFQLDLMGVPGIVVARTDA
ESATLLDGRGDERDQPFILGASNLAVPAFRAAFLAILRRFRRAGVEELSGHELYAVCDEE
YAAADAWLERTGFDKAIAAAAAEHQRGALAVDAALDRVFDRFVDAWQQEAGVCTYAEAVA
QAIAFREHEGEHPTMRRDEWMAFAARAPFYRAREKARAMGIDTPWDCEHAKTPDGYYQVR
GGIDYAIQKSLAAAPFADLLWMETKTADLADARRFADAIHAVHPDKMLAYNLSPSFNWDT
TGMDDEQMRRFPEELGKLGYVFDFITYGGHQIDGLAAEEFATALREDGMLALARLQRKFR
LLESGYRTPQTLVGGPRLDAALMAVSGRTATTKAMGQGSTQHQHLVQTEVPPRLLEDWLD
LWRERHGVQGKLRAALRPVTAGSDLLELVVTSADGERKLDVTFASITDRRGRSILSVRDQ
NTHDLALRRKRLMTLAQLFLFHRYRVDSAHYVTPTEDNQRQAEGMKALGLFRSVAQEVGA
IIVADVDRARVKALAARDHVALKALLGA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagcaggaggtcgcggccctgcgccgctggttcgagagcccacggttcgcg
ggcatccggcgcatccacaccgcccgcgaggtgatggagcagcgcggcacgatccgccag
gactacccggtggcgcgggaggccgccgaggcgttccacgcgcgcctgcgcgagctgttc
cagcagcggcgctgcatcaccacgttcggcccctactcgcccgggcaggccgtggccatg
aagaagatgggcatcgaggccatctacctgggcggctgggccacctcggccaagggctcg
gtgcaggaggaccccggccccgacctcgccagctacccgctcagccaggtgcccgacgag
gcggcgcccatcgtgcgcgcgctgctcacggcggaccggaaccagcaccacgcccgctcg
cgcatgaccgaggagcagcggcgcgccaccccggcggtggacttccggccgttcatcatc
gccgacgccgacaccggccacggcggcgacgcgcaggtgcgcaacctcgtccgccgcttc
gtcgaggtcggggtgcccggctaccacatcgaggaccagaagccgggcgtgaagaagtgc
gggcaccagggcggcaaggtgctggtcgccgaggacgagcagctgaagcgcctctccgcg
gcgcggttccagctcgacctcatgggcgtgcccgggatcgtggtggcgcgcaccgacgcg
gagtcggccacgctgctcgacggccgcggcgacgagcgcgaccagccgttcatcctgggc
gcgagcaacctcgcggtcccggcgttccgcgcggcgttcctggcgatcctgcgccggttc
cgccgcgccggcgtggaggagctctccggccacgagctgtacgcggtgtgcgacgaggag
tacgcggccgccgacgcctggctggagcggaccggcttcgacaaggccatcgccgccgcc
gccgccgagcaccagcgcggcgcgctcgcggtggacgccgcgctcgaccgggtgttcgac
cggttcgtggacgcgtggcagcaggaggccggcgtctgcacctacgccgaggcggtggcg
caggcgatcgcgttccgcgagcacgagggcgagcacccgaccatgcggcgggacgagtgg
atggcgttcgcagcgcgcgcgccgttctaccgggcgcgcgagaaggcgcgcgccatgggg
atcgacacgccctgggactgcgagcacgccaagacgccggacggctactaccaggtgcgc
ggcggcatcgactatgccatccagaagtcgctcgcggcggcgccgttcgccgacctgctc
tggatggagaccaagacggccgacctcgccgacgcgcggcgcttcgccgacgccatccac
gcggtccacccggacaagatgctcgcctacaacctgtccccgtcgttcaactgggacacg
accggcatggacgacgagcagatgcgccgcttccccgaggagctcggcaagctcgggtac
gtcttcgacttcatcacctacggcggccaccagatcgacgggctggcggcggaggagttc
gcgacggcgctgcgcgaggacggcatgctggcgctggcgcggctgcagcggaagttccgc
ctgctcgagtcgggctaccggacgccgcagacgctggtgggcggaccgcgcctcgacgcg
gcgctcatggccgtctccggccgcaccgccaccaccaaggccatgggccagggctcgacc
cagcaccagcacctggtccagaccgaggtgccgccgcggctgctggaggactggctcgac
ctttggcgcgagcggcacggcgtccagggcaagctgcgcgcggcgctccggccggtcacc
gcgggctccgacctgctcgagctggtggtcacctcggccgacggcgagcggaagctcgac
gtcaccttcgcgagcatcaccgaccggcgcgggcgcagcatcctgtcggtccgcgaccag
aacacgcacgacctggcgctgcggcgcaagcggctcatgacgctcgcgcagctgttcctg
ttccaccgctaccgggtggactcggcgcactacgtcacgcccaccgaggacaaccagcgg
caggcggagggcatgaaggcgctcgggctgttccgctcggtggcgcaggaggtcggtgcg
atcatcgtcgccgacgtggaccgggcgcgggtgaaggcgctcgccgcgcgggaccacgtg
gcgctgaaggcgctcctcggcgcctga

DBGET integrated database retrieval system