KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1966Help
Entry
A2cp1_1966        CDS       T00833                                 

Definition
two component LuxR family transcriptional regulator
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2220363..2221019
Genome map
AA seq 218 aa AA seqDB search
MSDKIRVVIVDDHAILREGVRALLQLQPDIEVVGEGADGMQALEQVERLDPDVVLMDIAM
PGLGGIEASLQLKKLGRRARILILSQYEDREYVRRLLKAGVSGYVLKKSAGAELANAVRA
VHRGGLVLDPEVARTAMEEAGPAAPGEADPYESLTDREKQVLKLVAEGRSNKEVADVLGI
SVKTAMSHREHVMEKLGVHNRTELVRFAIRKGVIRVDE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaagatccgggtggtcatcgtggacgaccacgccatcctgcgcgagggcgtg
cgtgcgctgctccagctccagcccgacatcgaggtggtcggcgagggcgccgacgggatg
caggcgctggagcaggtggagcggctcgatccggacgtggtgctgatggacatcgccatg
cccgggctgggcggcatcgaggccagcctccagctgaagaagctggggcggcgcgcgcgc
atcctgatcctctcgcagtacgaggatcgcgagtacgtccgccgcctgctcaaggccggc
gtgtcgggctacgtgctcaagaagtccgccggcgccgagctcgcgaacgccgtccgcgcg
gtccaccggggaggcctggtgctcgaccccgaggtcgcgcgcaccgccatggaggaggcc
ggcccggcggcgcccggcgaggcggatccctacgagtcgctcaccgaccgcgagaagcag
gtgctgaagctggtggccgaggggcggagcaacaaggaggtggcggacgtcctcggcatc
agcgtgaagaccgccatgagccaccgcgagcacgtgatggagaagctcggggtccacaac
cgcaccgagctcgtccgcttcgcgatccgcaagggcgtgatccgcgtggacgagtag

DBGET integrated database retrieval system