KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2105Help
Entry
A2cp1_2105        CDS       T00833                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_2105
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_2105
   00020 Citrate cycle (TCA cycle)
    A2cp1_2105
   00620 Pyruvate metabolism
    A2cp1_2105
Enzymes [BR:acp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A2cp1_2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2347176..2348501
Genome map
AA seq 441 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVAPGDAITEDQPLVEVMTDKATVVIPSPKRGTVVKLF
WNVGDVAKVHSPLVEIELDDAPPRPAPEAPVRAATAAATAQAAAAASVAVGRPAQAEPPA
AAAAPSAAAGPAGAKALATPAVRAMARELGIDVNTVPGTGPGGRVTKDDLSRARGKVNGH
GGETEVPAPAPAAARAPVPAPSPAGPPEADERIPLRGMRRKIAENMARSKRTAAHFTFVE
QADVTELVRVKDRIAAAAKEEGVRVTFLPFVVKAVVAALRKFPKLNASLDDERGEIVVKH
RYDLGVASATDAGLVVPVIRAADRRSLLDLAREIERLSQDTKAGRIRPEDLGSSTFTITS
LGALGGLFATPVLNHPEVGILGIHRIRPTPVVRDGQIVARDVMHVSLTSDHRVVDGHEAA
AFTYQVIRYLEDPNLLFMQMV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagctcgagctccccgacatcggcgagggggtcgtcgaggcggaggtccag
cagtggttcgtcgccccgggcgacgcgatcaccgaggatcagccgctcgtcgaggtgatg
accgacaaggcgacggtggtgatcccgtcgccgaagcgcggcacggtggtgaagctgttc
tggaacgtgggcgacgtcgccaaggtgcactcgccgctggtcgagatcgagctcgacgac
gcgccgccgcgcccggcgcccgaggcgccggtgcgcgccgccaccgcggccgcgacggcc
caggcggccgcggcggcgagcgtcgccgtgggccggccggcccaggccgagccgcccgcg
gcggcggcggccccctcggcggcggcagggcccgcgggcgcgaaggcgctcgccaccccc
gccgtgcgcgccatggcgcgggagctggggatcgacgtgaacacggtgccgggcaccggc
ccgggcggccgcgtcaccaaggacgacctgtcgcgcgcgcgcggcaaggtgaacgggcac
ggcggcgagacggaggtgccggccccggcgcccgccgcggcccgcgcccctgtgccggcg
ccgtcgccggccggcccgccggaggcggacgagcggatcccgctgcgcggcatgcggcgg
aagatcgccgagaacatggcgcgctcgaagcggaccgccgcccacttcacgttcgtggag
caggcggacgtcaccgagctggtccgggtgaaggaccggatcgccgccgccgcgaaggag
gagggcgtccgcgtcacgttcctgccgttcgtggtgaaggcggtcgtcgccgccctgcgc
aagttcccgaagctgaacgcgtcgctcgacgacgagcgcggcgagatcgtggtgaagcac
cggtacgacctcggcgtcgcgtcggccaccgacgcgggcctggtggtcccggtgatccgc
gcggccgatcgccgctcgctcctcgatctcgcccgggagatcgagcggctctcgcaggac
accaaggccgggcgcatccgccccgaggacctgggcagctccaccttcaccatcaccagc
ctgggcgcgctgggcgggctgttcgccaccccggtgctgaaccaccccgaggtcggcatc
ctgggcatccaccgcatccggcccacgccggtggtgcgcgacgggcagatcgtcgcccgc
gacgtgatgcacgtctcgctcacgagcgaccaccgcgtggtggacgggcacgaggcggcc
gcgttcacctaccaggtgatcaggtacctcgaggatcccaacctgctgttcatgcagatg
gtgtga

DBGET integrated database retrieval system