KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2214Help
Entry
A2cp1_2214        CDS       T00833                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A2cp1_2214
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A2cp1_2214
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A2cp1_2214
Enzymes [BR:acp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A2cp1_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2457494..2458852
Genome map
AA seq 452 aa AA seqDB search
MAAPAFSSWFRCADGCDFRAELTEVVYECPRCGGLLEVEHDRAALATRSAAEWKALFDGR
FKLGAWPYGSGVWGKKEWVYPGIADANVVSMFEGGSPLLRIDRYARELGLDDVWLKECGV
THTGSFKDLGMTVLVSAVKEMRARGAAVRAVACASTGDTSAALSAYCAAAGIPSVVLLPR
GKISTAQLVQPISNGALVLELDTDFDGCMQVVKQLSRTKDIYLANSMNSLRIEGQKTASI
EIAQQLGWTSPDWIVIPGGNLGNASAVGKGFLLMKELGVVDRLPRLVVAQAEHANPLWRA
TTGAGVKPTAAVEVAPLAARKTLASAIQIGAPVSARRALRALEALDGVVEQASEQELADA
AARADRAGMFTCPHTGVALAALEKLAARGVVKRGERVVVISTAHGLKFSDFKVGYHDQTL
PGIRAGLRNPAVQLPATLGAVQDAIAGRFGRG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcccgcgttctcgtcctggttccgctgcgcggacggttgcgacttccgcgcc
gagctcaccgaggtggtctacgagtgcccgcgctgcggcgggctgctcgaggtcgagcac
gaccgcgccgcgctcgcgacccggagcgccgccgagtggaaggcgctgttcgacgggcgc
ttcaagctgggcgcctggccgtacggctcgggggtatggggcaagaaggagtgggtctac
cccggcatcgccgacgccaacgtcgtctcgatgttcgagggcggcagcccgctgctccgc
atcgatcgctacgcccgcgaactcggcctcgacgacgtgtggctgaaggagtgcggggtc
acgcacaccgggtcgttcaaggacctgggcatgaccgtgctcgtctccgcggtgaaggag
atgcgggcccgcggcgccgccgtgcgcgcggtcgcctgcgcctccaccggcgacacctcg
gccgcgctctccgcctactgcgccgccgccggcatccccagcgtggtgctgctgccgcgc
ggcaagatctccaccgcgcagctcgtccagcccatctcgaacggcgcgctggtgctcgag
ctcgacaccgacttcgacggctgcatgcaggtggtgaagcagctcagccgcaccaaggac
atctacctcgcgaactcgatgaactcgctgcgcatcgaggggcagaagaccgcctccatc
gagatcgcgcagcagctcggctggacctcgccggactggatcgtgatcccgggcggcaac
ctggggaacgcgagcgcggtcgggaagggcttcctgctcatgaaggagctgggcgtggtg
gaccggctcccgcgcctggtggtcgcgcaggcggagcacgcgaacccgctctggcgggcc
accaccggcgccggggtgaagcccaccgccgcggtcgaggtcgcgccgctcgccgcccgg
aagacgctcgcctccgccatccagatcggcgccccggtgtcggcgcgccgcgcgctgcgc
gcgctggaggcgctcgacggcgtggtcgagcaggccagcgagcaggagctcgccgacgcg
gccgcgcgcgcggaccgggccggcatgttcacctgtccgcacaccggcgtggcgctcgcc
gcgctcgagaagctcgccgcgcgcggggtggtgaagcggggcgagcgggtggtggtgatc
tccaccgcgcacggcctcaagttctcggacttcaaggtcggctaccacgaccagaccttg
cccgggatccgcgccgggctgcgcaatccggccgtccagctccccgccacgctcggcgcg
gtccaggacgcgattgccggccgcttcgggcgagggtag

DBGET integrated database retrieval system