KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2221Help
Entry
A2cp1_2221        CDS       T00833                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    A2cp1_2221
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A2cp1_2221
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     A2cp1_2221
Lipid biosynthesis proteins [BR:acp01004]
 Desaturase
  First
   A2cp1_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2462380..2463243
Genome map
AA seq 287 aa AA seqDB search
MPRDPDRIDWLPSLPFFAAHLVALATPWLAPLEWRWGALAAGLYALRMFAVTAGYHRYFS
HRSYRTSRAFQLLLAVLGASAAQKGPLWWAAHHRDHHRHSDGPEDVHSPLERGFWWSHVG
WILSRRHHETKLDRVRDLARFPELRWIDRHHLVPPAALAIGLFLAGGLPALLWGFFVSTV
ALWHGTFVINSLAHVFGRRRYATDDGSRNSLVLALVTLGEGWHNNHHFYAASARQGFFWW
EIDLSWYALRALAAVRLVQDLKVPPPQVRLAHLRTAIPPAAARAEAL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgaccccgaccgcatcgactggctgccctcgctcccgttcttcgccgcgcac
ctcgtggcgctggccaccccgtggctggcgccgctcgagtggcgctggggcgcgctcgcg
gccgggctgtacgcgctgcgcatgttcgcggtgacggccgggtatcaccggtacttctcg
caccgcagctaccggacctcgcgcgcgttccagctcctgctcgcggtgctcggcgcgagc
gcggcgcagaagggcccgctctggtgggccgcccaccaccgcgaccaccaccgccactcc
gacgggccggaggacgtccactcgccgctggagcgggggttctggtggagccacgtgggc
tggatcctctcccgccgccaccacgagacgaagctcgaccgcgtgcgcgacctcgcgcgc
ttcccggagctgcggtggatcgaccgccaccacctggtgccgccggcggcgctcgccatc
gggctgttcctggcgggcgggctgccggcgctgctgtgggggttcttcgtctccaccgtc
gcgctctggcacggcacgttcgtcatcaactcgctcgcgcacgtgttcggccgccgccgc
tacgccaccgacgacggctcgcgcaacagcctggtcctcgcgctcgtgacgctgggcgag
gggtggcacaacaaccaccacttctacgcggccagcgcgcggcagggcttcttctggtgg
gagatcgatctgtcctggtacgcgctgcgcgcgctcgcggcggtgcgcctggtccaggac
ctgaaggtcccgccgccgcaggtccgcctggcgcacctccgcacggccatcccgcccgcc
gcggcgcgcgccgaggcgctctga

DBGET integrated database retrieval system