KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2221Help
Entry
A2cp1_2221        CDS       T00833                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:acp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:acp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2462380..2463243
Genome map
AA seq 287 aa AA seqDB search
MPRDPDRIDWLPSLPFFAAHLVALATPWLAPLEWRWGALAAGLYALRMFAVTAGYHRYFS
HRSYRTSRAFQLLLAVLGASAAQKGPLWWAAHHRDHHRHSDGPEDVHSPLERGFWWSHVG
WILSRRHHETKLDRVRDLARFPELRWIDRHHLVPPAALAIGLFLAGGLPALLWGFFVSTV
ALWHGTFVINSLAHVFGRRRYATDDGSRNSLVLALVTLGEGWHNNHHFYAASARQGFFWW
EIDLSWYALRALAAVRLVQDLKVPPPQVRLAHLRTAIPPAAARAEAL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgaccccgaccgcatcgactggctgccctcgctcccgttcttcgccgcgcac
ctcgtggcgctggccaccccgtggctggcgccgctcgagtggcgctggggcgcgctcgcg
gccgggctgtacgcgctgcgcatgttcgcggtgacggccgggtatcaccggtacttctcg
caccgcagctaccggacctcgcgcgcgttccagctcctgctcgcggtgctcggcgcgagc
gcggcgcagaagggcccgctctggtgggccgcccaccaccgcgaccaccaccgccactcc
gacgggccggaggacgtccactcgccgctggagcgggggttctggtggagccacgtgggc
tggatcctctcccgccgccaccacgagacgaagctcgaccgcgtgcgcgacctcgcgcgc
ttcccggagctgcggtggatcgaccgccaccacctggtgccgccggcggcgctcgccatc
gggctgttcctggcgggcgggctgccggcgctgctgtgggggttcttcgtctccaccgtc
gcgctctggcacggcacgttcgtcatcaactcgctcgcgcacgtgttcggccgccgccgc
tacgccaccgacgacggctcgcgcaacagcctggtcctcgcgctcgtgacgctgggcgag
gggtggcacaacaaccaccacttctacgcggccagcgcgcggcagggcttcttctggtgg
gagatcgatctgtcctggtacgcgctgcgcgcgctcgcggcggtgcgcctggtccaggac
ctgaaggtcccgccgccgcaggtccgcctggcgcacctccgcacggccatcccgcccgcc
gcggcgcgcgccgaggcgctctga

DBGET integrated database retrieval system