KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2459Help
Entry
A2cp1_2459        CDS       T00833                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2716177..2717028)
Genome map
AA seq 283 aa AA seqDB search
MRMRIGARLFDGPGPFVMGVVNATPDSFSDGGRFLERDAAVAHALRLADEGADLVDLGGE
STRPGAPPVTADEELRRVVPVVAALRARGFTLPISVDTWKARVAREALAAGADLVNDVTG
LADPDMGGVVAGAGVPIVLQHMRGTFADMATRAVYADVVEEVAAELDEALARAGAAGIPR
DRVVLDPGIGFAKDARQSLELLARVGELRRLGCPLLVGPSRKSFIGKVTGAPAAERLPGT
LAAVTACVLAGVELVRVHDVAAARQAADVAAAIRGAARAPGPL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgcggatcggggccaggctcttcgacgggcctggccccttcgtcatgggggtc
gtgaacgcgaccccggactcgttctcggacggcggccggttcctcgagcgcgacgcggcg
gtggcgcacgcgctgcggctcgcggacgagggcgccgatctggtggacctgggcggcgag
tccacccggcccggcgcgccgccggtgacggccgacgaggagctccggcgggtggtgccg
gtcgtcgccgcgctgcgcgcgcgcgggttcacgctcccgatctcggtggacacgtggaag
gcgcgggtggcgcgggaggcgctcgcggccggggcggacctggtgaacgacgtgaccggc
ctcgccgacccggacatgggcggcgtggtcgccggggccggcgtgccgatcgtgctccag
cacatgcgcggcacgttcgccgacatggccacgcgcgcggtgtatgcggacgtggtcgag
gaggtcgccgccgagctggacgaggcgctggcccgggccggggcggccggcatcccgcgc
gatcgcgtggtgctcgaccccggcatcggcttcgcgaaggacgcccggcagagcctggag
ctgctggcgcgggtcggggagctgcggcgcctcgggtgcccgctgctggtgggcccgtcg
cgcaagagcttcatcgggaaggtcaccggcgcgcccgcggcggagcgcctgcccggcacg
ctcgcggcggtgaccgcgtgcgtgctggccggcgtggagctggtgcgcgtccacgacgtc
gcggccgcccggcaggcagccgacgtcgcggccgcgatccggggagcggcgcgcgctccc
ggtccgctgtag

DBGET integrated database retrieval system