KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2515Help
Entry
A2cp1_2515        CDS       T00833                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2781088..2782110)
Genome map
AA seq 340 aa AA seqDB search
MPATREPAALNLPPRVPLARLPTPIEPSPRVGAALGLDLLYKRDDLTGLELSGNKARKLE
YLLAEAEAAGADTLVTCGGVQSNHCRATAFAAAKRGLRAVLLLRVPDPARPPAPEANVLL
DRLAGAEIRWVSHDEYRRRAELMDAVASELRAAGRRAYVIPEGGSSPLGSLGYLLAVAEL
RRQLPEAWRTGPLTLAYAVGSGGTGAGLELGVRALGWKDARPVGFAVCNDAAYFRATIAA
LCADARRRWPALPEVPADELRIDDGFIGPGYAQATSDGLEIIRRAAREDGVLLDPVYTGK
AMLGLATRAREPGGLPAPRVVFFHTGGAFGLFPFANALAG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccggccacccgtgaacccgccgccttgaacctgccgccgcgcgtcccgctcgcccgg
ttgcccacgcccatcgagccgtcgcctcgcgtgggggccgcgctcggcctcgacctgctc
tacaagcgcgacgacctcaccggcctcgagctgtccggcaacaaggctcggaagctggag
tacctgctcgccgaggccgaggccgccggcgcggacacgctcgtgacctgcggcggcgtg
cagtccaaccactgccgcgccaccgcgttcgcggccgcgaagcgcgggctgcgcgcggtg
ctcctgctgcgcgtgccggacccggcgcggccgcccgcgcccgaggcgaacgtgctgctc
gatcggctggccggcgcggagatccgctgggtctcgcacgacgagtaccggcgccgcgcc
gagctcatggacgcggtggcgtcggagctgcgcgccgccgggcggcgggcctacgtgatc
ccggagggcgggtcgtcgccgctcgggagcctcgggtacctgctggccgtggccgagctg
cgccggcagctcccggaggcgtggcggaccgggccgctgacgctggcgtacgccgtgggc
tcgggcggcaccggcgccggcctcgagctcggggtgcgcgcgctggggtggaaggacgcg
aggccggtgggcttcgcggtgtgcaacgacgcggcgtacttccgcgcgaccatcgcggcg
ctgtgcgcggacgcgcgccgccggtggccggcgctgcccgaggtgccggcggacgagctc
cggatcgacgacgggttcatcggcccgggctacgcccaggccacctccgacgggctggag
atcatccgccgcgccgcgcgcgaggacggggtgctcctcgatccggtctacaccggaaag
gcgatgctcggactggcgacgcgagcgcgcgagccgggggggctgcccgcgccgcgcgtc
gtgttcttccacaccggcggtgcgttcggcctgttcccgttcgcgaacgcgctggccggc
tga

DBGET integrated database retrieval system