KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2515Help
Entry
A2cp1_2515        CDS       T00833                                 

Definition
(RefSeq) D-cysteine desulfhydrase (EC:3.5.99.7)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A2cp1_2515
Enzymes [BR:acp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     A2cp1_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2781088..2782110)
Genome map
AA seq 340 aa AA seqDB search
MPATREPAALNLPPRVPLARLPTPIEPSPRVGAALGLDLLYKRDDLTGLELSGNKARKLE
YLLAEAEAAGADTLVTCGGVQSNHCRATAFAAAKRGLRAVLLLRVPDPARPPAPEANVLL
DRLAGAEIRWVSHDEYRRRAELMDAVASELRAAGRRAYVIPEGGSSPLGSLGYLLAVAEL
RRQLPEAWRTGPLTLAYAVGSGGTGAGLELGVRALGWKDARPVGFAVCNDAAYFRATIAA
LCADARRRWPALPEVPADELRIDDGFIGPGYAQATSDGLEIIRRAAREDGVLLDPVYTGK
AMLGLATRAREPGGLPAPRVVFFHTGGAFGLFPFANALAG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccggccacccgtgaacccgccgccttgaacctgccgccgcgcgtcccgctcgcccgg
ttgcccacgcccatcgagccgtcgcctcgcgtgggggccgcgctcggcctcgacctgctc
tacaagcgcgacgacctcaccggcctcgagctgtccggcaacaaggctcggaagctggag
tacctgctcgccgaggccgaggccgccggcgcggacacgctcgtgacctgcggcggcgtg
cagtccaaccactgccgcgccaccgcgttcgcggccgcgaagcgcgggctgcgcgcggtg
ctcctgctgcgcgtgccggacccggcgcggccgcccgcgcccgaggcgaacgtgctgctc
gatcggctggccggcgcggagatccgctgggtctcgcacgacgagtaccggcgccgcgcc
gagctcatggacgcggtggcgtcggagctgcgcgccgccgggcggcgggcctacgtgatc
ccggagggcgggtcgtcgccgctcgggagcctcgggtacctgctggccgtggccgagctg
cgccggcagctcccggaggcgtggcggaccgggccgctgacgctggcgtacgccgtgggc
tcgggcggcaccggcgccggcctcgagctcggggtgcgcgcgctggggtggaaggacgcg
aggccggtgggcttcgcggtgtgcaacgacgcggcgtacttccgcgcgaccatcgcggcg
ctgtgcgcggacgcgcgccgccggtggccggcgctgcccgaggtgccggcggacgagctc
cggatcgacgacgggttcatcggcccgggctacgcccaggccacctccgacgggctggag
atcatccgccgcgccgcgcgcgaggacggggtgctcctcgatccggtctacaccggaaag
gcgatgctcggactggcgacgcgagcgcgcgagccgggggggctgcccgcgccgcgcgtc
gtgttcttccacaccggcggtgcgttcggcctgttcccgttcgcgaacgcgctggccggc
tga

DBGET integrated database retrieval system