KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2529Help
Entry
A2cp1_2529        CDS       T00833                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00010  Glycolysis / Gluconeogenesis
acp00071  Fatty acid degradation
acp00350  Tyrosine metabolism
acp00625  Chloroalkane and chloroalkene degradation
acp00626  Naphthalene degradation
acp01100  Metabolic pathways
acp01110  Biosynthesis of secondary metabolites
acp01120  Microbial metabolism in diverse environments
acp01130  Biosynthesis of antibiotics
acp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_2529
  Lipid metabolism
   00071 Fatty acid degradation
    A2cp1_2529
  Amino acid metabolism
   00350 Tyrosine metabolism
    A2cp1_2529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A2cp1_2529
   00626 Naphthalene degradation
    A2cp1_2529
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A2cp1_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACL65867
JGI: A2cp1_2529
UniProt: B8JCC7
Position
2798948..2799931
Genome map
AA seq 327 aa AA seqDB search
MRAMVLARPGAPLAPAELPDPVPGPGELRLRVGACGVCRTDLHVADGELPDPKLPLVLGH
EIVGRVDRVGAGVTRFRPGDRVGIPWLGWTCGRCAACRSGRENLCSAARFTGYHRDGGYA
ELAVADARYAFAIPGDYEDADAAPLLCAGLIGHRAWAPVRGAQRLGLYGFGAAAHLVVQL
ARHAGQRVFAFTRPGDAEAQAFALQLGAEWAGASGEVPPEPLDAAILFAPVGALVPIALR
DVVPGGTVVCAGIHMSDIPSFPYALLWGERTLRSIANLTRADGDALLALAPEVPLRTEVV
PYPLERANDALADLRAGRLRGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatggtcctcgcccgcccgggcgccccgctcgccccggcggagctccccgat
cccgtccccggacccggcgagctgcggctgcgggtgggcgcctgcggcgtgtgccgcacc
gacctgcacgtcgccgacggggagctgccggacccgaagctgccgctggtgctcggccac
gagatcgtcgggcgggtggatcgggtcggggccggggtgacccgcttccggcccggcgat
cgggtggggatcccgtggctgggctggacgtgcggccggtgcgcggcctgccggagcggc
cgggagaacctgtgcagcgcggcgcggttcaccggctaccaccgcgacggcggctacgcc
gagctggccgtcgcggacgcgcgctacgcgttcgccatccccggggactacgaggacgcc
gacgcggcgccgctgctctgcgccggcctcatcggccaccgcgcctgggcgccggtccgc
ggcgcccagcgactcggcctctacggcttcggggccgcggcgcacctggtggtgcagctc
gcccggcacgcggggcagcgcgtgttcgcgttcacccggcccggggacgccgaggcgcag
gcgttcgcgctgcagctcggggccgagtgggccggcgcctcgggcgaggtgccgcccgag
ccgctcgacgccgccatcctgttcgcgccggtgggcgcgctcgtgcccatcgcgctccgc
gacgtggtgccgggcggcaccgtggtctgcgctggcatccacatgagcgacatcccctcg
ttcccgtacgcgctgctgtggggcgagcggaccctccgctcgatcgcgaacctcacccgc
gccgacggcgacgcgctgctcgcgctcgcgcccgaggtcccgctccgcaccgaggtcgtc
ccgtacccgctggagcgcgccaacgacgcgctcgccgacctccgcgccggccggctgcgc
ggggcggcggtgctggtgccgtga

DBGET integrated database retrieval system