KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2529Help
Entry
A2cp1_2529        CDS       T00833                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A2cp1_2529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_2529
  Lipid metabolism
   00071 Fatty acid degradation
    A2cp1_2529
  Amino acid metabolism
   00350 Tyrosine metabolism
    A2cp1_2529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A2cp1_2529
   00626 Naphthalene degradation
    A2cp1_2529
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A2cp1_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2798948..2799931
Genome map
AA seq 327 aa AA seqDB search
MRAMVLARPGAPLAPAELPDPVPGPGELRLRVGACGVCRTDLHVADGELPDPKLPLVLGH
EIVGRVDRVGAGVTRFRPGDRVGIPWLGWTCGRCAACRSGRENLCSAARFTGYHRDGGYA
ELAVADARYAFAIPGDYEDADAAPLLCAGLIGHRAWAPVRGAQRLGLYGFGAAAHLVVQL
ARHAGQRVFAFTRPGDAEAQAFALQLGAEWAGASGEVPPEPLDAAILFAPVGALVPIALR
DVVPGGTVVCAGIHMSDIPSFPYALLWGERTLRSIANLTRADGDALLALAPEVPLRTEVV
PYPLERANDALADLRAGRLRGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatggtcctcgcccgcccgggcgccccgctcgccccggcggagctccccgat
cccgtccccggacccggcgagctgcggctgcgggtgggcgcctgcggcgtgtgccgcacc
gacctgcacgtcgccgacggggagctgccggacccgaagctgccgctggtgctcggccac
gagatcgtcgggcgggtggatcgggtcggggccggggtgacccgcttccggcccggcgat
cgggtggggatcccgtggctgggctggacgtgcggccggtgcgcggcctgccggagcggc
cgggagaacctgtgcagcgcggcgcggttcaccggctaccaccgcgacggcggctacgcc
gagctggccgtcgcggacgcgcgctacgcgttcgccatccccggggactacgaggacgcc
gacgcggcgccgctgctctgcgccggcctcatcggccaccgcgcctgggcgccggtccgc
ggcgcccagcgactcggcctctacggcttcggggccgcggcgcacctggtggtgcagctc
gcccggcacgcggggcagcgcgtgttcgcgttcacccggcccggggacgccgaggcgcag
gcgttcgcgctgcagctcggggccgagtgggccggcgcctcgggcgaggtgccgcccgag
ccgctcgacgccgccatcctgttcgcgccggtgggcgcgctcgtgcccatcgcgctccgc
gacgtggtgccgggcggcaccgtggtctgcgctggcatccacatgagcgacatcccctcg
ttcccgtacgcgctgctgtggggcgagcggaccctccgctcgatcgcgaacctcacccgc
gccgacggcgacgcgctgctcgcgctcgcgcccgaggtcccgctccgcaccgaggtcgtc
ccgtacccgctggagcgcgccaacgacgcgctcgccgacctccgcgccggccggctgcgc
ggggcggcggtgctggtgccgtga

DBGET integrated database retrieval system