KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_2732Help
Entry
A2cp1_2732        CDS       T00833                                 

Definition
peptidase M23
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3012423..3013745
Genome map
AA seq 440 aa AA seqDB search
MQVPRFDDAPRRRRLPVLLAGAGFLALLILALAGAAGGLRTVPGAPAAPVAAAPEAAAML
PAPTTATLAPHKPTPAERFRAVTVRLARNQTLAQALVKLDVPMAQVNAVVASLKGLFPFH
RARPGDQLRVERRDEDGELHRFSYRQGPADEWTVERKEDGSFEARKRPVELTTEVARVAV
KVEGSLWASLERAGEDPELAVLASDVLAWDVDFYQDVRAGDAMTMVVEKVLADGKLLRYG
EVLAAEYKGEAAGRKRLFRYTDPDGHTSYYDENGNSARRGFLKSPLKLARVTSGFGMRNH
PLLGYVRAHQGVDYGAPTGTPVWAVGDGQVREAGWKGGCGKAVVLKHRNGLESVYCHLSA
VAVSAGKAVSQKQVIGYVGSTGLSTGPHLHFAVKRGGSFVNPLRLQIPRDAPIPAKWAAD
FAEKIAPVRASLAGEPVALN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtacctcgcttcgacgacgccccccgccgccgccgcctccccgtgctgctcgcc
ggcgccggcttcctcgccctcctgatcctcgcgctcgccggagccgccggcggcctccgc
acggtgcccggcgcgccggccgccccggtcgctgctgcgcccgaggccgcggccatgctg
cccgcgcccaccaccgccacgctcgccccgcacaagcccacgccggcggagcggttccgc
gcggtgacggtgcggctcgcccgcaaccagaccctcgcgcaggcgctggtgaagctcgac
gtgccgatggcgcaggtgaacgcggtggtggcctcgctgaaggggctgttcccgttccac
cgcgcccgccctggcgaccagctccgggtggagcgccgcgacgaggacggcgagctgcac
cggttcagctaccggcaggggccggcggacgagtggaccgtggagcgcaaggaggacggg
tccttcgaggctcgcaagcgcccggtcgagctgaccaccgaggtggcgcgcgtggcggtg
aaggtggagggctcgctatgggcgtcgctggagcgcgccggcgaggatcccgagctggcc
gtgctcgcctccgacgtgctggcctgggacgtcgacttctaccaggacgtccgcgccggc
gacgccatgaccatggtggtcgagaaggtgctcgccgacggcaagctgctccgctacggc
gaggtgctggccgccgagtacaagggcgaggcggccggccgtaagcggctgttccgctac
accgatccggacggccacaccagctactacgacgagaacggcaacagcgcgcggcgcggc
ttcctgaagtcgccgctcaagctcgcgcgcgtcacctccggcttcgggatgcgcaaccac
ccgctgctcggctacgtccgcgcccaccagggcgtggactacggcgcgcccaccggcacg
ccggtctgggccgtcggggacgggcaggtccgcgaggccggctggaagggcggctgcggc
aaggcggtggtgctgaagcaccgcaacggcctggagtcggtctactgccacctgtcggcg
gtggcggtctccgcgggcaaggcggtgtcgcagaagcaggtcatcggctacgtcggctcg
accggcctctcgaccggcccgcacctgcacttcgcggtgaagcgcggcgggtccttcgtg
aacccgctccggctgcagatcccgcgcgacgcgcccatccccgcgaagtgggccgccgac
ttcgccgagaagatcgcgccggtgcgggccagcctggccggcgagccggtcgcgctcaac
tag

DBGET integrated database retrieval system