KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3274Help
Entry
A2cp1_3274        CDS       T00833                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    A2cp1_3274
Enzymes [BR:acp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     A2cp1_3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3642229..3643860
Genome map
AA seq 543 aa AA seqDB search
MPGPQPDAPFDYDYLVIGSGFGGSVSALRLAEKGWRVGVLEMGKRWRPEDFPRTNWNLRK
FLWIPRLRLFGIQQITLLKDVLVLHGAGVGGGSLVYANTLLSPPDRAFEDPRWPGGGWKA
RLAPHYAMARFMLGAVLAPEVFPGDEALRQAVEEETGRGDTFARHTVAVHFGDPKRAAPD
PYFGGEGPARIGCSLCGECMTGCRHGAKNTLDRNYLYLAERRGAEILPETRVTDLRPLVG
GGWEVHTRSSTHVVRRQRRVLRARGVVLAAGAIGTVRLLLRCRAGGSLPALSDQLGNHVR
TNSEALLAVTARRDDVDYSHGLAITSGLQADDDTHMEVVRYGAGHDFMSLLATHLTGGGP
PWPRPLRWLGNLFRHPVDFFRAHWPFGWARRTAVLLVMQPLASHLRLRLARRPWGRSLTS
ALDGPRPPSYMPLANAVARRMAARMDGVAQSGLHEVFLGASSTAHILGGATMGASPAEGV
CDAQGRVFGYQDLYVADGSLVPANLGVNPSLTITALAEHVMSRIPASPAGAQRPAPRPPG
GAA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccccagcccgacgcccccttcgactacgactacctggtgatcggctccggc
ttcggcggctcggtgtccgcgctgcggctggccgagaagggctggcgcgtcggcgtgctc
gagatgggcaagcgctggcggccggaggacttcccgcgcaccaactggaacctgcgcaag
ttcctgtggataccgaggctgcggctgttcgggatccagcagatcacgctgctgaaggac
gtcctggtgctgcacggcgctggcgtgggcggcggcagcctggtctacgcgaacacgctg
ctctccccgccggaccgcgccttcgaggatccgcgctggccgggcggcggctggaaggcg
cgcctcgcgccgcactacgcgatggcgaggttcatgctcggcgcggtcctggcgccggaa
gtgttcccgggcgacgaggcgctgcgccaggcggtggaggaggagaccgggcgcggcgac
accttcgcgcgccacaccgtcgcggtgcacttcggcgacccgaagcgcgccgcaccggac
ccgtacttcggcggcgaggggccggcgcggatcggctgctcgctgtgcggcgagtgcatg
acgggctgccgccacggcgcgaagaacacgctcgaccggaactacctctacctggccgag
cggcgcggcgccgagatcctgccggagacgcgggtcaccgacctccgcccgctcgtgggc
ggaggctgggaggtccacacgcggtcgtccacgcacgtggtccggcgccagcggcgcgtg
ctccgcgcgcgcggcgtggtgctggccgcgggcgcgatcggcacggtgcgcctgctgctc
cgctgcagggcgggcgggagcctgccggcgctctccgatcagctcggcaaccacgtgcgc
accaacagcgaggcgctgctcgccgtcaccgcgcgccgcgacgacgtggactacagccac
gggctcgccatcacctcggggctgcaggcggacgacgacacgcacatggaggtcgtccgc
tacggcgcgggccacgacttcatgtcgctcctcgccacccacctcaccggcggcggcccg
ccctggccgcgcccgctgcgctggctcgggaacctgttccggcacccggtggacttcttc
cgcgcgcactggccgttcggctgggcgcgccgcaccgcggtgctgctcgtgatgcagccg
ctcgcgagccacctgcggctgcggctcgcgcgccggccgtgggggcgatccctcaccagc
gcgctcgacggcccgcggccgccgagctacatgccgctcgcgaacgcggtggcgcgcagg
atggcggcgcgcatggacggggtggcgcagagcgggctccacgaggtgttcctgggcgcc
tcgagcaccgcgcacatcctgggcggcgcgaccatgggcgcctcgccggccgagggcgtg
tgcgacgcgcagggacgcgtgttcggctaccaggacctctacgtcgccgacggcagcctg
gtgcccgcgaacctgggcgtgaacccgtcgctcaccatcaccgcgctggccgagcacgtc
atgagccggatccccgccagccccgccggcgcgcagcggccggccccgcgtccgccgggt
ggcgccgcgtga

DBGET integrated database retrieval system