KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3543Help
Entry
A2cp1_3543        CDS       T00833                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_3543
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A2cp1_3543
   00620 Pyruvate metabolism
    A2cp1_3543
   00640 Propanoate metabolism
    A2cp1_3543
  Energy metabolism
   00680 Methane metabolism
    A2cp1_3543
Enzymes [BR:acp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A2cp1_3543
Lipid biosynthesis proteins [BR:acp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A2cp1_3543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3960886..3962784
Genome map
AA seq 632 aa AA seqDB search
MSSKKTQLEGEVFYPSAEVATQARVPDWAALAKRADEDLEGFWAAEAEELEWYRKWDKVL
DASEKPFYRWFKGAQTNIVHNCLDRHQRTWRKNKLSLVWVGEKGEVRTYSYFALNRDVSK
FANVLKAMGVKKGDRVTIYMPRIPEIVIAMLAAAKIGAIHSVVYGGFSVDALQGRIEDSE
SKVVITADGGFMNGKIVELKKTVDDAVRRCPTVETVIVVQRTAHEVRMEAGRDYWYHELM
KLPLAAGVCPTEVMDSTDPLYILYTSGTTGKPKGLIHGHGGYQVGIYSTLKYVFDIKDED
RYWCAADPGWVTGHSYIVYGPLLMGATTFMYEGAPTYPYPNRWWSLVEKYGITILYTAPT
AIRGLMRFGESWPNRHDLSTLRLLGSVGEPINPEAWKWYHRVIGKGRCPVMDTWWQTETG
MFMITPVPTLPLKPGSAAKPFFGQQVSILDDNGKAVPDGEEGFLVLERPWPAMAMTVYKD
PERFVKTYWEKYPGRYMAGDAAKRDADGYYWVIGRTDDVIKVSGYRLGTAEIESALVSHP
AIAEAAVIGLPHEVKGQAIHCYCLLRQGFKPSPELEDEVKQHVAQHLGPIVRPEKVTFVD
SLPKTRSGKIMRRVLKARAQGLPEGDVSTLEE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaagaagacgcagctggaaggtgaggtcttctacccctccgccgaggtggcc
acgcaggcgcgcgtgccggactgggccgcgctggcgaagcgcgccgacgaggacctggag
ggcttctgggccgcggaggccgaggagctcgagtggtaccggaagtgggacaaggtcctc
gacgcctccgagaagccgttctaccgctggttcaagggcgcgcagaccaacatcgtccac
aactgcctggaccgccaccagcgcacctggcgcaagaacaagctctcgctggtgtgggtg
ggcgagaagggcgaggtccggacgtactcgtatttcgcgctgaaccgcgacgtgtccaag
ttcgcgaacgtcctgaaggccatgggcgtgaagaagggcgaccgcgtcaccatctacatg
ccccgcatccccgagatcgtgatcgccatgctggcggccgcgaagatcggcgccatccac
tcggtggtgtacggcgggttctcggtggacgcgctgcagggccgcatcgaggactcggag
tcgaaggtcgtgatcaccgccgacggcgggttcatgaacgggaagatcgtcgagctgaag
aagacggtggacgacgccgtccgccgctgcccgacggtggagaccgtgatcgtggtccag
cgcaccgcgcacgaggtccgcatggaggcgggccgcgactactggtaccacgaactgatg
aagctccccctcgccgcgggcgtctgcccgaccgaggtgatggactccaccgacccgctc
tacatcctctacacctccggcaccaccgggaagccgaaggggctcatccacgggcacggc
ggctaccaggtcggcatctactccacgctcaagtacgtcttcgacatcaaggacgaggac
cgctactggtgcgcggcggatccgggctgggtcaccggccacagctacatcgtgtacggg
ccgctgctcatgggcgcgaccacgttcatgtacgagggcgcgccgacctacccgtacccg
aaccgctggtggtcgctggtcgagaagtacggcatcaccatcctctacaccgcgcccacc
gccatccgcggcctgatgcgcttcggcgagtcgtggccgaaccgccacgacctctccacg
ctccggctgctcggctcggtgggcgagcccatcaaccccgaggcgtggaagtggtaccac
cgcgtcatcggcaagggccgctgcccggtgatggacacgtggtggcagaccgagaccggc
atgttcatgatcacgccggtcccgacgctcccgctgaagcccggctcggcggcgaagccg
ttcttcggccagcaggtctcgatcctcgacgacaacggcaaggcggtccccgacggcgag
gaggggttcctggtgctggagcggccctggccggcgatggccatgaccgtctacaaggac
cctgaacggttcgtgaagacctactgggagaagtacccgggccgctacatggccggggac
gccgccaagcgcgacgccgacggctactactgggtcatcggccgcaccgacgacgtcatc
aaggtctccggctaccgcctcggcaccgccgagatcgagagcgccctggtgtcgcacccg
gccatcgccgaggcggcggtgatcgggctgccgcacgaggtgaaggggcaggccatccac
tgctactgcctgctgcgccagggcttcaagccgagccccgagctggaggacgaggtgaag
cagcacgtggcgcagcacctcgggcccatcgtgcggccggagaaggtgacgttcgtggac
tcgctgcccaagacgcgctccggcaagatcatgcggcgcgtgctcaaggcgcgcgcccag
gggctccccgagggcgacgtctccacgctggaggagtga

DBGET integrated database retrieval system