KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3608Help
Entry
A2cp1_3608        CDS       T00833                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A2cp1_3608
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A2cp1_3608
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A2cp1_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4028279..4029757)
Genome map
AA seq 492 aa AA seqDB search
MASYVLAIDQGTTGTTVLVLDRRLSPRARVNQEFRQIFPKPGWVEHDLEDIWGSTVSTVQ
RALREAGIRGSDVAAVGITNQRETTALWERRSSRPVAHAIVWQDRRTTDACAQLRSAGHE
PLVRERTGLVLDPYFSATKLRWLLDNTKGARQKAEAGALAFGTIDSFLVWRLTGGAAHVT
DVSNASRTLLMDLRERRWDRELLDLFGVPPNVLPEIRASSEVYGTTRGVKVLPDGIPVAG
MAGDQQAALFGQACFRPGEAKCTYGTGAFLLQNVGPEPVMSSRGLLTTVAWTVGGETAYA
LEGSSFIAGAAVQWLRDGLGLIARAPDVEALAKQVKSTGELVFVPALAGLGAPHWRPEAR
GLIAGIDRGTTAAHLARATLEGIAFLIHDLAEAMRAEAGKPFPVFKVDGGASQNDLLMQF
QADLLEVPVERPRMIETTALGAAFLAGLAVGFWKDREEIRRAWQVGKRFEPKMKPVEREQ
HVAKWRKAVQGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggccagctacgtcctcgccatcgaccagggcaccaccggcaccaccgtgctggtcctc
gaccggcgcctctcgccgcgcgcgcgcgtgaaccaggagttccggcagatcttcccgaag
ccgggctgggtcgagcacgatctcgaggacatctggggctcgaccgtgtccaccgtgcag
cgtgcgctccgcgaggcggggatccgcggctccgacgtcgccgcggtgggcatcaccaac
cagcgcgagaccacggcgctgtgggagcgccgctcctcgcgcccggtggcgcacgccatc
gtctggcaggatcgccgcaccaccgacgcgtgcgcgcagctgcgctccgccgggcacgag
ccgctggtgcgcgagcggaccggtctggtgctcgatccgtacttctccgccacgaagctg
cggtggctgctcgacaacaccaagggcgcgcggcagaaggccgaggccggcgcgctggcg
ttcgggaccatcgacagcttcctggtgtggcggctcaccggcggcgcggcgcacgtcacc
gacgtctcgaacgcgagccgcaccctgctcatggacctgcgggagcggcgctgggatcgc
gagctcctggacctgttcggcgtcccgcccaacgtgctcccggagatccgcgcgtcgtcg
gaggtgtacggcaccacccgcggggtgaaggtgctcccggacggcatcccggtggcgggc
atggccggcgaccagcaggcggcgctgttcggccaggcctgcttccggccgggcgaggcg
aagtgcacctacggcaccggcgcgttcctgctccagaacgtcgggccggagccggtgatg
tcgtcgcgcggcctgctcaccaccgtcgcgtggacggtcgggggcgagacggcgtacgcg
ctggagggctcctcgttcatcgccggcgccgcggtgcagtggctccgcgacgggctgggg
ctcatcgcgcgcgcgcccgatgtggaggcgctcgcgaagcaggtgaagtccaccggcgag
ctggtgttcgtgccggcgctggcggggctgggcgcgccgcactggcggccggaggcgcgc
gggctcatcgcgggcatcgaccgcggcaccaccgcggcgcacctggcgcgcgccacgctc
gaggggatcgccttcctcatccacgacctcgccgaggcgatgcgcgccgaggcgggcaag
ccgttcccggtcttcaaggtggacggcggcgcctcccagaacgacctgctcatgcagttc
caggctgacctgctcgaggtgccggtggagcggccgcgcatgatcgagaccaccgcgctc
ggcgccgcgttcctggccggcctggcggtgggcttctggaaggaccgcgaggagatccgc
cgcgcctggcaggtggggaagcgcttcgagccgaagatgaagccggtcgagcgagagcag
cacgtggcgaagtggcggaaggcggtccagggggcgtag

DBGET integrated database retrieval system