KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3609Help
Entry
A2cp1_3609        CDS       T00833                                 

Definition
alpha/beta fold family hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
Enzymes [BR:acp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     A2cp1_3609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4029761..4030627)
Genome map
AA seq 288 aa AA seqDB search
MVRTSSARGDEFELPGGPDAVLLLHGLTGSTFEVLPVAERLHAAGMRCLAPRMAGHAGGP
AALGEVSYTEWIAQARRDLERLAGARRTFLVGCSMGALVACALAHDHPARADGLVLLAPA
LELQLQGRLGALLGRLGPLRRVVIPKAAGSDVRDPEMRAANPAFPGVPLGAVAELAKLAR
HVDAQLPGIAAPALVIAGGHDHTVTLGGARRVARRIGSGPAALRVLPESWHLVGIDVERE
RCAEEAARFLEALPIPGGRRRHPGTAPRRPRAAGGTKAKARAGRRRRG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtggtccggacctccagcgcgcgcggcgacgagttcgaactccccggtgggcccgacgcg
gtcctgctgctgcacggcctcaccggctcgacgttcgaggtcctccccgtcgcggagcgg
ctccacgccgccggcatgcgctgcctcgccccgcggatggccggccacgccggcggcccc
gcggcgctgggcgaggtctcgtacacggagtggatcgcgcaagcccggcgcgacctggag
cggctcgctggcgcgcgccgcaccttcctggtgggctgctcgatgggcgcgctggtcgcc
tgtgcgctggcccacgaccacccggcgcgtgccgacggcctcgtgctgctggccccggcg
ctggagctgcagctgcagggccggctgggcgcgctgctggggcggctcggcccgctccgg
cgcgtggtgatcccgaaggcggccggctccgacgtgcgcgaccccgagatgcgcgccgcg
aaccccgccttcccgggcgtgccgctcggcgcggtggccgagctggcgaagctggcgcgc
cacgtggacgcgcagctgcccggcatcgccgcgccggccctggtcatcgcaggcgggcac
gaccacacggtcacgctcggcggcgcgcgccgcgtggcgcggcgcatcggctccggcccc
gccgcgctgcgggtcctgccggagagctggcacctcgtgggcatcgacgtggagcgggag
cgctgcgccgaggaggccgcgcgcttcctggaggcgctgccgatcccgggcggccgccgc
cgccaccccggcacggcgccgcgccgccccagggcggcgggcgggacgaaggcgaaggcc
cgcgccgggcgccggcgcagggggtga

DBGET integrated database retrieval system