KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_3906Help
Entry
A2cp1_3906        CDS       T00833                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:acp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4344531..4346021
Genome map
AA seq 496 aa AA seqDB search
MRLSTVIAGSGARGDLAGDPEITRVTGDSREVIPGAVFFALPGVQHDGHAFAAEAARRGA
IAVVAERPVECAPARLLLAPSARRAMALAAASFHGRPAERLRMAAVTGTNGKTTVTYLVE
ACARAAAVPVGVLGTISFRFPGADRPASHTTPESTAIQAVLAEMVAAGARDAVMEVSSHA
LAQERVAGIRFQAAGFTNLTRDHLDYHRDMDAYFAAKRRLFTEHLAPGGTAVINARDPWG
ARLADQLGPGPRVWRYGVRAGDALRALEVRTGLAGTSATFETPAGAIAIRSPLVGQHNLE
NLLCAAGLALGLGLPPEAVARGLAASHGAPGRLERIDGRGLSVFVDYAHTDDALARMIAA
LRGLSPRRLICVFGCGGDRDRGKRPLMGAAAAAADLAIVTSDNPRTEDPLAIIADVLPGL
DRAGKPSLGAARARAGEDGYLVEPDRRAAIALAVECAREGDAVLVAGKGHEDYQQVGAEK
RPFSDRDEARKALGIA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaggctctccaccgtcatcgccggcagcggcgcccgcggcgatctcgccggcgatccc
gagatcacccgcgtcaccggcgactcgcgggaggtgatcccgggcgcggtgttcttcgcg
ctccccggcgtccagcacgacggccacgccttcgccgccgaggcggcgcgacggggcgcc
atcgccgtggtcgccgagcggccggtcgagtgcgcgcccgcgcggctgctgctcgccccg
tccgcgcgcagggccatggcgctcgccgccgccagcttccacggccggccggccgagcgc
ctccgcatggccgcggtcaccggcacgaacgggaagacgaccgtcacctacctggtggag
gcgtgcgcgcgcgccgccgcggtgccggtgggcgtgctcgggacgatctcgttccgcttc
cccggcgcggaccggcccgccagccacaccactccggagtccaccgccatccaggcggtg
ctggcggagatggtcgcggccggcgcgagggacgcggtgatggaggtctcgtcgcacgcg
ctcgcgcaggagcgggtggccgggatccgcttccaggcggccggcttcacgaacctcacg
cgcgaccacctcgactaccaccgcgacatggacgcgtacttcgcggcgaagcgccggctg
ttcaccgagcacctcgcgcccggcggcaccgcggtgatcaacgcgcgcgatccctggggc
gcgcgcctggccgaccagctcgggccggggccgcgcgtctggcgctacggcgtccgggcc
ggcgacgcgctgcgcgcgctcgaggtgcggaccggcctcgccggcaccagcgcgacgttc
gagacgccggccggcgccatcgcgatccgctccccgctcgtcggccagcacaacctcgag
aacctgctctgcgccgcgggcctcgcgctcggcctgggcctgccgccggaggcggtcgcc
cgcggcctcgccgcctcgcacggcgcgccgggccggctggagcggatcgacggccgcggc
ctgtcggtcttcgtggactacgcccacaccgacgacgcgctggcgcgcatgatcgcggcg
ctgcgcgggctctcgccgcggcggctgatctgcgtgttcggctgcggcggcgaccgggac
cgcggcaagcgcccgctcatgggcgcggcggccgcggccgcggacctcgccatcgtcacc
agcgacaacccgcgcaccgaggacccgctcgccatcatcgccgacgtgctgcccggcctg
gaccgcgccgggaagccctccctcggcgccgcccgcgcgcgcgccggcgaggacggctac
ctggtcgagccggaccgtcgcgccgccatcgcgctcgcggtggagtgcgcgcgcgagggc
gacgcggtgctcgtcgccggcaaggggcacgaggactaccagcaggtgggcgccgagaag
cgccccttctccgaccgcgacgaggcgcgcaaggcgctcgggatcgcatga

DBGET integrated database retrieval system