KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4047Help
Entry
A2cp1_4047        CDS       T00833                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A2cp1_4047
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A2cp1_4047
   00630 Glyoxylate and dicarboxylate metabolism
    A2cp1_4047
Enzymes [BR:acp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A2cp1_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4521220..4523523
Genome map
AA seq 767 aa AA seqDB search
MIRADILDQFPDLFGRKRVNGRELDVDATIETLTRELEPDIEAALTARGALLRSPEPVAT
KYAWPHWNEAFEDPVGGSAWTFRQIVQGMIDNFLGKESPLRWRLNDEVPIPEHVHPSRNP
GLELTGPWHPLDMAFNALNSPAPMNMPDFEDASPPHFRPDGAPAREPVGVFAALKNAKDI
FEGRWSDRAYEVEKKGKVRSYRITTPQAKWPTRLARPPSLHVRYDHVTVDGRPAPGLVVV
ATLWTLNGYDPLTRVGSGAYFYIPKLQTPREALIVERLLSRLEGMIGVPAGTLKAKMLYE
EGNAGRQLPAIVWTLRRRLLGTNVGRWDYLGSLIEMWKDDPQGVFPDPQTVGMATPGMLA
YQRYNALLMLMAGMKDGELTHAAPIGGMAAVMIYQGGDPYGRARYNPLALRAMVIDKLRE
RLLGLFFVPDAPLRPGELPTLDAILSGKVRGTLHDAYRQSWVASPEPEYVGAGNGPLRAR
VGALQELLDAPVELVDAGGKPVPTVASGLSDAERAVFHARGLVDANGRITPFVLAREHVD
APEKLLDRARWEAIYRVPEGDVTIEHVQHAFYMAANYGFQILNGNFAAAIDDYELKLRFM
NDLATYRINVSWLWALLRHQAPVTKDGHLLRATLTGDGVVLGKPAEPVKAGTHLDRALFE
KVYTFHGEWTDAFFAEQDRRGEPARFDRSKAPVIMELLHRQLLSPRYIQHSARALFVIGA
ARPEDRAGLLDAMFDLERADVAARVEKGALPKGALEAHDYVNDVFGG
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcggacatcctcgaccagttccccgacctgttcggccgcaagcgcgtcaac
ggccgcgagctcgacgtggacgcgaccatcgagacgctcacccgcgagctcgagccggac
atcgaggccgcgctgaccgcgcgcggcgcgctgctccgctcgcccgagccggtggccacg
aagtacgcgtggccgcactggaacgaggcgttcgaggatcccgtgggcgggagcgcctgg
acgttccgccagatcgtccagggcatgatcgacaacttcctcggcaaggagagcccgctg
cgctggcggctcaacgacgaggtgccgatccccgagcacgtccacccgtcgcgcaacccg
ggcctggagctgaccgggccctggcacccgctcgacatggcgttcaacgcgctcaacagc
ccggcgccgatgaacatgccggacttcgaggacgcctcgccgccgcacttccgccccgac
ggcgcgcccgcgcgcgagccggtgggcgtgttcgcggcgctcaagaacgcgaaggatatc
ttcgaggggcgctggtccgaccgcgcctacgaggtcgagaagaaggggaaggtccgcagc
taccggatcacgacgccgcaggcgaagtggcccacgcgcctggcgcgcccgcccagcctg
cacgtgcgctatgaccacgtcaccgtggacggccggcccgcgccgggcctggtggtggtg
gcgacgctctggacgctgaacggctacgacccgctcacccgcgtcggcagcggcgcgtac
ttctacatcccgaagctgcagacgccgcgcgaggcgctcatcgtggagcggctgctgtcg
cgcctggaggggatgatcggcgtgcccgccggcacgctcaaggcgaagatgctctacgag
gaggggaacgccggccgccagcttcccgccatcgtctggacgctgcggcggcggctgctc
ggcacgaacgtcggccgctgggactacctcggcagcctcatcgagatgtggaaggacgat
ccgcagggcgtcttccccgacccgcagaccgtgggcatggcgacgcccgggatgctcgcc
taccagcgctacaacgcgctcctcatgctcatggccggcatgaaggacggcgagctgacc
cacgccgcgcccatcggcggcatggccgcggtgatgatctaccagggcggcgatccctac
ggccgcgcgcgctacaacccgctcgcgctccgcgccatggtgatcgacaagctgcgcgag
cggttgctgggcctgttcttcgtgcccgacgcgccgctccggcccggcgagctccccacg
ctcgacgcgatcctctccggcaaggtccgcggcacgctccacgacgcctaccggcagagc
tgggtggcgagcccggagcccgagtacgtgggtgccggcaacggcccgctccgcgcgcgg
gtgggcgcgctgcaggagctgctcgacgcgccggtggagctggtggacgcgggcgggaag
ccggtgcccacggtggcgagcgggctctcagacgccgagcgggccgtgttccacgcgcgc
ggcctggtggacgcgaacgggcgcatcacgccgttcgtgctggcgcgcgagcacgtggac
gcgccggagaagctcctcgaccgggcgcgctgggaggcgatctaccgggtgcccgagggc
gacgtcaccatcgagcacgtccagcacgcgttctacatggcggcgaactacgggttccag
atcctgaacggcaacttcgccgccgccatcgacgactacgagctgaagctccgcttcatg
aacgacctcgccacctaccgcatcaacgtgtcctggctgtgggcgctcctgcgtcaccag
gcgcccgtcacgaaggacggccacctgctccgcgccacgctcaccggggacggcgtggtg
ctcggcaagcccgccgagccggtgaaggccgggacgcacctcgatcgcgcgctgttcgag
aaggtgtacacgttccacggtgagtggacggacgcgttcttcgccgagcaggaccgccgc
ggcgagcccgcgcgcttcgaccgctccaaggcgcccgtcatcatggagctgctgcaccgg
cagctcctctccccgcgctacattcagcacagcgcccgcgcgctgttcgtgatcggcgcc
gcccgccccgaggaccgcgccggcctgctcgacgccatgttcgacctcgagcgcgccgac
gtcgccgcgcgggtggagaagggcgcgcttccgaagggcgcgctggaggcgcacgactac
gtgaacgacgtgttcggggggtag

DBGET integrated database retrieval system