KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4201Help
Entry
A2cp1_4201        CDS       T00833                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A2cp1_4201
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A2cp1_4201
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A2cp1_4201
Enzymes [BR:acp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A2cp1_4201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4687197..4688054
Genome map
AA seq 285 aa AA seqDB search
MSPRPARKPRAAAAPVAAERPDRISAAFERCRAERRAALVTYVMGGDPDLATARDMALAC
VEGGADLVELGVPFSDPIADGPTIQAAAQRALGAGTTLEDVLGIAAAVRARSQVPIALMG
YLNPMLAGGVERLVRGCADAGVDALIIPDLLPEEAEVLAPASAEAGVKLVYLLAPTSNPA
RVEAAARAATGFLYFVSVTGVTGARHAVAEEIAPLVSAVRARTDLPVVIGFGVASPEQAR
ALGPLADGVVVGSAIVKRIAEGGSRRARAERVTRFVRSLGRALRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcgccccgcccgcaagccccgcgccgccgccgcgcccgtcgcggccgagcgc
cccgaccgcatctcggccgcgttcgagcgctgccgcgccgagcgccgggccgcgctcgtc
acctacgtgatgggcggcgaccccgacctcgccaccgcgcgggacatggcgctcgcctgc
gtggagggcggcgccgacctcgtcgagcttggggtgccgttctcggatcccatcgccgac
ggccccaccatccaggccgccgcgcagcgcgcgctcggcgctggcaccacgctcgaggac
gtgctcgggatcgccgccgcggtccgcgcgcgctcgcaggtccccatcgcgctcatgggc
tacctcaaccccatgctggcgggcggggtcgagcggctcgtgcgcggctgcgccgacgcc
ggcgtggacgcgctcatcatccccgacctgctgcccgaggaggccgaggtgctcgccccg
gcgtcggccgaggccggcgtgaagctggtctacctgctcgcgcccacctcgaacccggcc
cgcgtcgaggccgcggcccgggccgccaccggcttcctctacttcgtgtcggtgaccggc
gtgaccggggcgcgccacgcggtggccgaggagatcgcgccgctcgtgtccgcggtgcgg
gcccggaccgacctgccggtggtcatcggcttcggcgtggcctcgcccgagcaggcgcgc
gcgctcggcccgctcgccgacggcgtggtggtcgggagcgcgatcgtgaagcggatcgcc
gagggcggctcgcggcgcgctcgcgccgagcgggtcacgcggttcgtgcgatcgctgggg
cgcgcgctgcggcgctga

DBGET integrated database retrieval system