KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4213Help
Entry
A2cp1_4213        CDS       T00833                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A2cp1_4213
Enzymes [BR:acp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A2cp1_4213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4695546..4696253
Genome map
AA seq 235 aa AA seqDB search
MARAPRPRAVPPRPAHRARSLPRERALVSAVVETCHRLAALDLIGAGEGNVSVRLGPDAF
LVTASGVNKGQLRPGHVLRIDGDGAVTRGAGRPSTELRMHLAAYAARPDVEAIVHAHPIT
AVALTVAGAPPPNDLVPEAAVTLGEIALAPFATPGTGEVPASLAPYLARHDVLLLERHGA
LALGRTLAEALDRMETLERVARIALAARLAGRCTPLPGDAVDRVLLAAGKPARKR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgccccccgcccgcgcgccgtccctccccgccccgcgcaccgcgcgcggagc
ctcccgcgggagcgcgcgctcgtctcggcggtggtggagacctgccaccggctggccgcg
ctcgacctcatcggcgcgggcgaggggaacgtctcggtgcggctcgggccggacgcgttc
ctggtcaccgcctcgggcgtgaacaaggggcagctccggcccggacacgtgctgcgcatc
gacggcgacggcgcggtgacccgcggcgcgggccgcccctcgaccgagctgcggatgcac
ctcgccgcctacgcggcgcggccggacgtggaggccatcgtccacgcccaccccatcacc
gcggtggcgctcaccgtcgcgggcgcgccgccgccgaacgacctcgtgccggaggcggcg
gtgacgctgggcgagatcgcgctcgcgccgttcgcgacgcccggcaccggcgaggtgccc
gcctcgctcgcgccgtacctggcccgccacgacgtgctgctgctcgagcgccacggcgcg
ctcgcgctggggcgcacgctcgccgaggcgctcgaccggatggagacgctggagcgggtg
gcgcggatcgcgctcgccgcccggctcgcgggccgctgcacgccgctgcccggggacgcg
gtggaccgggtgctcctcgccgccggcaagccggcgcggaagcgctag

DBGET integrated database retrieval system