KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4214Help
Entry
A2cp1_4214        CDS       T00833                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
acp00790  Folate biosynthesis
acp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A2cp1_4214
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A2cp1_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACL67531
JGI: A2cp1_4214
UniProt: B8JAN2
Position
complement(4696395..4696886)
Genome map
AA seq 163 aa AA seqDB search
MRAYVGVGSNLGDRWANLALAARVLRASPGVAVLRASHVFDTPPMGPPQPRYLNAVLELE
AGLTPEALHAVLASAERAAGRRRGLRWGPRTLDLDLLVHADRVVRTPALMVPHPGIAARR
FVLEPLAELAPDLVVPGLGRTVAELLASAPGAPLVVAGLYPLP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgtacgtgggcgtgggcagcaacctcggcgatcgctgggccaacctggcgctc
gcggcccgcgtgctgcgcgcctcgccgggcgtggcggtgctgcgggcctcgcacgtgttc
gacacgccgcccatgggcccgccgcagccccgctacctgaacgcggtgctggagctggag
gcggggctcacgccggaggcgctgcacgcggtgctcgcctcggccgagcgcgccgccggc
cgccgccgcggcctgcgctggggcccgcgcacgctcgacctcgacctgctcgtccacgcg
gatcgcgtggtgcggacgcccgcgctcatggtcccgcaccccggcatcgcggcgcgccgc
ttcgtgctcgagccgctcgccgagctggcgccggacctggtggtgccggggctgggccgc
acggtcgccgagctgctggcgagcgcgcccggcgcgccgctggtggtcgcgggcctgtac
ccgctgccctag

DBGET integrated database retrieval system