KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4214Help
Entry
A2cp1_4214        CDS       T00833                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A2cp1_4214
Enzymes [BR:acp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A2cp1_4214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4696395..4696886)
Genome map
AA seq 163 aa AA seqDB search
MRAYVGVGSNLGDRWANLALAARVLRASPGVAVLRASHVFDTPPMGPPQPRYLNAVLELE
AGLTPEALHAVLASAERAAGRRRGLRWGPRTLDLDLLVHADRVVRTPALMVPHPGIAARR
FVLEPLAELAPDLVVPGLGRTVAELLASAPGAPLVVAGLYPLP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgtacgtgggcgtgggcagcaacctcggcgatcgctgggccaacctggcgctc
gcggcccgcgtgctgcgcgcctcgccgggcgtggcggtgctgcgggcctcgcacgtgttc
gacacgccgcccatgggcccgccgcagccccgctacctgaacgcggtgctggagctggag
gcggggctcacgccggaggcgctgcacgcggtgctcgcctcggccgagcgcgccgccggc
cgccgccgcggcctgcgctggggcccgcgcacgctcgacctcgacctgctcgtccacgcg
gatcgcgtggtgcggacgcccgcgctcatggtcccgcaccccggcatcgcggcgcgccgc
ttcgtgctcgagccgctcgccgagctggcgccggacctggtggtgccggggctgggccgc
acggtcgccgagctgctggcgagcgcgcccggcgcgccgctggtggtcgcgggcctgtac
ccgctgccctag

DBGET integrated database retrieval system