KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4251Help
Entry
A2cp1_4251        CDS       T00833                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4732756..4733868
Genome map
AA seq 370 aa AA seqDB search
MNLTDTLALLLRPAGGGIHLVSSGKAEQLALQRRLYGADDEREIRARWREDLERAATARA
VVLGIPSDVGAGFRRGANLGPAAIRERLLADDPSRSARDRADGVVDLGDVFVVPQLLHDN
MLGEAQLAASRRALYPDLPADEAARLPVSPLSIAEHALSLVLEVNPRARVFAVGGDHSTA
WPVVKALSARWPGLGIVQIDAHTDLLEDRLGIRYCFGTWSYHANELVGRGGRLVQVGTRA
SGRDRAHWESTLGVRQFWAADVLADPRAALDAILAHVKATGVSSVYFTNDIDGTDQQWAD
ATGTPEPGGLTPAFVSALVRRLGSEVGLAGGDVMEVAPGIAGGEGAGPRTVGLAAGYLAE
TIDAALGRTR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcaccgacacgctcgcgctcctcctccgccccgccggcggcggcatccacctc
gtctccagcggcaaggccgagcagctcgcgctgcagcgccggctctacggcgccgacgac
gagcgcgagatccgcgcgcgctggcgcgaggacctggagcgcgccgccaccgcgcgcgcg
gtggtgctgggcatcccctccgacgtgggggcgggcttccgccgcggcgcgaacctgggc
ccggccgccattcgcgagcggctgctcgccgacgatccgtcgcgcagcgcgcgcgaccgc
gccgacggggtggtggacctcggcgacgtgttcgtggtcccgcagctcctccacgacaac
atgctgggcgaggcgcagctcgccgccagccgccgcgcgctctacccggacctcccggcg
gacgaggcggcgcgcctgccggtgtcgccgctctccatcgcggagcacgcgctgtcgctg
gtgctggaggtgaacccgcgcgcccgcgtgttcgcggtcggcggcgatcactccaccgcc
tggccggtggtgaaggcgctctcggcgcgctggccgggcctcggcatcgtgcagatcgac
gcccacaccgacctgctcgaggaccggctcggcatccgctactgcttcggcacctggtcg
taccacgcgaacgagctggtgggccgcggcgggcggctggtgcaggtgggcacgcgcgcc
tcggggcgcgaccgcgcgcactgggagtccacgctcggcgtgcggcagttctgggcggcc
gacgtgctcgccgatccgcgcgcggcgctggacgcgatcctggcgcacgtgaaggcgacc
ggcgtgtcctcggtgtacttcaccaacgacatcgacgggaccgatcagcagtgggccgac
gccaccggcacgcccgagccgggcggcctcaccccggcgttcgtttcggcgctcgtccgg
cggctgggcagcgaggtggggcttgcgggcggcgacgtgatggaggtcgcgccggggatc
gcgggcggcgagggcgcggggccgcgcacggtggggctcgcggcgggctacctcgccgag
accatcgacgcggcgctgggccggacccggtga

DBGET integrated database retrieval system