KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_4420Help
Entry
A2cp1_4420        CDS       T00833                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A2cp1_4420
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    A2cp1_4420
Enzymes [BR:acp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A2cp1_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4917898..4918995)
Genome map
AA seq 365 aa AA seqDB search
MPTPTSLDAQVAGLFCVGFDGKTASPEVLELIRRGVHGVVLFARNVESAEQVAALTAELK
RAAGRPLLVAVDQEGGRVARLRARHGFTELPPMRAVGEVGDAGLAREVGALLGRELRAVG
IDQDYAPVVDVDTNPANPVIGDRSLSRDPETVGRLGAAIALGLQSAGVAACAKHFPGHGD
TSQDSHTDLPRLPHALERLRAVELAPFRALARAGVASVMTAHVVFEALDRDRPATLSPAV
MRLLREEVGFDGCAISDDLEMQAVAGHFPLEESAPGAVAAGVDALLVCHSPAVQHRAIDL
VRAAVETGRIPGDRVAEARGRVGRLLAYAGPPPDPARVRERLRTPEHLALVENVPALEVG
RDPTV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccccgacctccctcgacgcccaggtcgccggcctgttctgcgtcggcttcgac
ggcaagaccgcctcgcccgaggtgctcgagctcatccgccgcggcgtccacggcgtggtg
ctgttcgcgcgcaacgtggagagcgccgagcaggtcgcggcgctcaccgccgagctgaag
cgcgccgcagggcggccgctgctcgtggcggtggaccaggagggcgggcgggtggcgcgg
ctgcgggcgcgccacggcttcaccgagctgccgcccatgcgcgcggtgggcgaggtcggc
gacgccgggctggcgcgcgaggtgggcgcgctgctcggccgcgagctgcgggcggtcggc
atcgaccaggactacgcgccggtggtggacgtggacaccaaccccgccaacccggtcatc
ggcgaccgcagcctgtcccgcgatccggagacggtcggccgcctcggcgccgccatcgcg
ctcgggctccagtcggccggggtggccgcctgcgccaagcacttccccgggcacggcgac
acgagccaggactcgcacaccgacctgccccgcctcccgcacgcgctggagcggctccgg
gcggtggagctcgcgccgttccgcgcgctggcgcgcgccggggtggcctcggtcatgacc
gcccacgtggtgttcgaggcgctcgaccgcgatcgcccggccacgctctcgccggcggtg
atgcgcctgctgcgcgaggaggtcggcttcgacggctgcgccatctccgacgacctggag
atgcaggcggtggccgggcacttcccgctcgaggagtcggcgcccggggcggtggcggcc
ggggtggacgcgctgctcgtctgccactcgcccgcggtacagcaccgggccatcgacctg
gtgcgcgccgcggtggagacgggtcgcatccccggggaccgggtcgccgaggcccggggc
cgggtgggtcggctgctcgcgtacgcgggtccgccgccggacccggcccgggtgcgggag
cggctgcgcacgccggagcacctggcgctggtcgagaacgtcccggcgctcgaggtcggc
cgcgacccgaccgtctga

DBGET integrated database retrieval system