KEGG   Acidiphilium cryptum JF-5: Acry_0058Help
Entry
Acry_0058         CDS       T00527                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:acr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
61003..62448
Genome map
AA seq 481 aa AA seqDB search
MDGLSRYGAPPGWILPPETVFSGITADSRAVRKGMIFAALPGARADGRDFIAQAVAQGAA
AVLAPSGTRWPPGVPPRPLIEDPEPRRRLAEIAATLAGPLPETILGVTGTNGKTSTVDFI
RQMAVASGRPAASLGTLGLIAPGFAPGASLTTPDPVTLSDILAALRAAGIGTVALEASSH
GLDQFRLHGLRLAAGGFSNLTRDHLDYHGDMASYRRAKLRLFQDLLLPGAPAVAMADLEP
DTLAALRDIAQARRLDLATVGAGGDLFDLRGIIATPSSQVLTIACGGVSREIELPLPGRF
QVDNALLAAGLARAAGVSDPLDRLPGLAPVRGRLERAAVLPNGAAAYVDYAHTPDALERL
LMALRPHAAGRLVLVFGAGGDRDRGKRKLMGDVAARLADVAIVTDDNPRSEDPASIRAAI
LAACPGAREIGDRRAAIAAGLDALRAGDVLAVAGKGHESGQIVGDAVLPFDDAAVIRELA
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggacggtctttcacgttacggtgccccgccaggctggatcctgccgccggagacggtg
ttttccggaatcaccgctgacagccgcgccgtgcgcaagggcatgatcttcgccgccttg
ccgggcgcgcgcgccgatgggcgagatttcatcgcccaggccgtggcacagggggccgcc
gcggtgctggcgccttcgggcacccgctggccgcctggcgtgccgccacgcccgctgatc
gaggacccggagccgcggcgccgcctggccgagatcgcggcgacgctggcaggaccgctg
ccggagacgattctcggcgtgacaggcaccaatgggaagacctcgacggtggatttcatc
cgccagatggcagtggccagcgggagaccggccgcctcgctcggcacgctcgggctgatc
gcgccgggcttcgcgccgggggcaagcctgaccacgccggatccggtgaccctctccgat
atccttgccgcgttgcgggcggccggaatcgggaccgttgcgctcgaggcctcctcgcat
gggctcgaccagttccgcctgcatgggctgcgccttgccgctggcgggttcagcaacctg
acacgcgatcatctcgattatcacggggacatggcgtcctaccgtcgggccaagttgcgg
ctgttccaggacctgctgcttcccggcgcgccggcggtggcaatggccgatcttgagccg
gatacgctggcggcactgcgcgacatcgcgcaggcgcggcggctcgatctggcgacggtg
ggcgcgggcggtgacctgtttgacctgcgcggcatcatcgcgacgccgtccagccaagtg
ctgacgatcgcgtgcggtggcgtatcgcgcgagatcgaactgccgcttccgggccggttc
caggtggataatgcgttgcttgcggcaggcctcgcgcgtgcggcaggcgtgtccgatccg
ctggacaggctgccaggcctcgcgccggtgcgcgggaggctggagcgcgcggcggtgctg
ccgaatggcgctgccgcctatgtcgattacgcgcacacgccggatgcgctggagcggttg
ctgatggcgctgcgcccgcacgcggccggacggctggtgctggtgttcggcgcgggcggc
gatcgggatcgcggcaagcggaagctgatgggtgatgtggccgcgagactcgcggatgtc
gcgatcgtcaccgacgacaatccgcggagcgaggacccggcatcgatccgcgcggcaatc
ctcgcggcctgccccggcgcgcgggagatcggcgaccggcgtgccgcgatcgctgccgga
ctcgatgcgctgcgggcgggcgacgtgctggccgtggctggcaagggacatgagagcggg
cagatcgtcggtgatgcggtgctgcccttcgacgatgcggcggtgatcagggaacttgcg
gcatga

DBGET integrated database retrieval system