KEGG   Acidiphilium cryptum: Acry_0085Help
Entry
Acry_0085         CDS       T00527                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
acr  Acidiphilium cryptum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Acry_0085
Enzymes [BR:acr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Acry_0085
    3.5.1.-  
     Acry_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(93545..94156)
Genome map
AA seq 203 aa AA seqDB search
MDSRTALLVIDVQTDFCAGGALAVPNGDVVVPVINALARHYQTVVITQDWHPADHVSFAS
QHPGRSPFETIPLVYGTQVLWPDHCVMDSPGAALHRDLHIPHAAVIQRKGLNRLIDSYSA
FLEADRTTRTGLDGWLAARGIERVDLCGLATDYCVAWSAQDARRFGLEARVIEPACRGID
LDGSLAAAWQAMTAAGVARIAAV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgcaccgcgcttctcgtcatcgatgtccagacagatttttgcgccggaggt
gcccttgccgtaccgaatggcgacgtggtggtgccggtgatcaacgctcttgcgcggcac
taccagacggtcgtcatcacgcaggactggcacccggccgaccatgtctccttcgccagc
cagcatccgggacggtctccgttcgaaaccatacccctcgtctacggaacgcaggtgctc
tggccggatcactgcgtgatggacagccccggcgcagcgctgcaccgcgacctccatatt
ccccatgccgcagtgatccagcgcaagggattgaatcgcctgatcgattcctattccgcc
ttcctggaagccgatcggacaacccgcacgggtctcgacggctggctcgccgcccgcggc
atcgagcgggtcgatctctgcggcctcgcgactgactattgtgtcgcctggtcggcacag
gatgcgaggcgcttcggtctggaagcacgtgtgatcgagccggcctgccggggcatcgat
ctggatggatcgctggcggcagcgtggcaggcgatgaccgcggcaggcgtggcgcggatc
gccgcggtctga

DBGET integrated database retrieval system