KEGG   Acidiphilium cryptum JF-5: Acry_0121Help
Entry
Acry_0121         CDS       T00527                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
acr  Acidiphilium cryptum JF-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(133425..134510)
Genome map
AA seq 361 aa AA seqDB search
MAGMSSDSSSPLETVARPIADDRPVLVTGATGFVGAAVARALVRHGFRLRLMHRASSDMR
NLAQLPGERVVGDLTDPNSLAQAVEGCAHIFHVAADYRLYVPDPTAMRAVNIDGTIALFR
AAQADGACRMVYTSSVAALGLTHDGSPADEATPHAAEDHVGPYKRSKYEAELAVKKLVAE
GLDIVIVNPAAPVGPGDIKPTPTGRMVLDAARGHMPAYVETGMNIVHVDDVAEGHVLALT
RGRRGESYILGGENLMLSEIGRMITRLAGKPPPRVKLPIGPLMPVAALMEAWARISGHEP
LMTRDMLTMARKRMFYSSEKAVRELGYHARPAEEAMRDALADFCRRGLLPSLAFEPDGAT
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcatgagcagcgattcttcttctccgctcgagacggttgcgcgccccatcgcc
gacgaccggccggttcttgtcaccggcgcgaccggcttcgtcggcgccgccgtggcccga
gcgctggtccggcacggtttcaggctgcggctgatgcaccgcgcttcgagcgacatgcgc
aatctcgcgcaactgcccggcgagcgggtggtcggtgacctcaccgatccaaactcgttg
gcgcaagcggtcgagggctgcgcgcacatctttcacgtggccgccgattatcgtctctac
gtgcccgatccgacggcgatgcgggcggtgaatatcgacggcaccattgccctgttccgc
gcggcacaggcggacggggcgtgccggatggtctataccagcagcgtcgccgctctcggc
ctgactcacgatggcagcccggccgacgaggcgacgccgcatgcggcggaggatcatgtc
ggcccctacaagcggtcgaaatacgaggccgagttggcggtgaagaagcttgtcgccgag
gggttggatatcgtcatcgtcaatccggccgccccggttggaccaggcgacatcaagccg
acgccgaccggccgcatggtgctggacgccgctcgcggccatatgccagcctatgtcgag
accggcatgaacatcgtgcatgtggatgacgtcgccgagggtcatgtgcttgctctgacg
cggggacggcgcggcgagagctatattctcggtggcgagaatctcatgctctccgaaatc
gggcgaatgatcacacggctggccggcaagccgccgccacgggtaaaattgccgatcggc
ccgctgatgccggttgcggcgctcatggaagcctgggcgcggatctcgggccatgagccg
ctgatgacgcgcgacatgctgaccatggcgcgaaagcggatgttctattcttcggagaag
gccgttcgggaactcggctatcatgcccgcccggcagaggaagcgatgcgcgatgcgctc
gccgatttctgccgccgcggcctactgccgagcctcgccttcgagccggatggagcgacc
gcatga

DBGET integrated database retrieval system