KEGG   Acidiphilium cryptum: Acry_0181Help
Entry
Acry_0181         CDS       T00527                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
acr  Acidiphilium cryptum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acry_0181
Enzymes [BR:acr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Acry_0181
Exosome [BR:acr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acry_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(205407..206402)
Genome map
AA seq 331 aa AA seqDB search
MITGSFPTTRLRRNRRDGWTRRMVAETTLSVDNLIWPIFVRAGDGEPTPVATMPGVVRVG
LDRLAAHVEPAARLGIPAIALFPATPPELKNPEGTEALNPDNLICQAARLLKREFPELGL
IGDVALDPYTDHGHDGVLREGYVANDESVEILERQAVNQALAGIDVIAPSDMMDGRIGSI
RAALDSEGLIDTRIMSYAAKYASAFYGPFREALGSNAALKGDKKTYQMDPANTDEALREV
AMDIDEGADMVMVKPGMPYLDIIRRVHERFAVPTFAYQVSGEYAMLATAMEHGLLDRERG
ILETLMGFRRAGAAGVLTYFAVEAATLLRRG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccggcagctttccgaccacccgcctgcgccgcaaccgccgcgatggctggacg
cggcgcatggtcgccgagaccacgctgtcggtggacaatctgatctggccgatcttcgtc
cgcgccggcgatggcgagccgacgccggtcgccaccatgccgggtgtcgtgcgggtcggg
ctcgaccgcctcgccgcccatgtcgagccggcggcgcggctcggtattccggccatcgcc
ctgtttcccgccaccccgcccgagctcaagaaccccgagggcaccgaggcgctgaacccg
gacaacctgatctgccaggccgcccggctgctcaagcgcgaattccccgagctcggcctg
atcggcgatgtggcgctcgatccctataccgatcacgggcatgacggcgtgctgcgcgaa
ggctatgtcgccaacgacgaatcggtcgagatcctcgaacgccaggcggtgaaccaggcg
ctcgccgggatcgacgtgatcgcgccctcggacatgatggacgggcggatcggcagcatc
cgcgccgccctcgattccgaggggctgatcgacacgcggatcatgagctacgccgccaaa
tacgcctccgccttctacggcccgttccgcgaggcgctcggctccaacgcggcgctgaag
ggcgacaagaagacctaccaaatggaccccgccaacaccgacgaggcgctgcgcgaggtg
gcgatggacatcgacgagggcgccgacatggtgatggtcaagccgggcatgccctatctc
gacatcatccgccgcgtgcacgagcgcttcgcggtgccgaccttcgcctatcaggtgagc
ggcgaatacgcgatgctcgccaccgcgatggaacacgggctgctcgaccgcgagcgcggc
attctcgaaacgctgatgggcttccgccgcgccggcgccgccggggtgctcacctatttc
gcggtggaagcggcaaccctgctgcgccggggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system