KEGG   Acidiphilium cryptum JF-5: Acry_0189Help
Entry
Acry_0189         CDS       T00527                                 

Definition
PTS system fructose subfamily transporter subunit IIC
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:acr00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:acr02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217022..218716
Genome map
AA seq 564 aa AA seqDB search
MSDIVAIIAGGEGTVTRALAAEALRRAAREAGHDIEIEVRTGEGVLDPLAASRIAVAGVA
IEVGGSEAGDPRFAGKATIRATLADVLADAAAVLGRAAGTTPPGGRRIVAITSCPTGIAH
TFMAAEGLLQAAKALGHEIRVETQGSVGAGTPLTEDEIAAADIVLIAADRQVDLGRFGGK
RVFQSGTKPAINDGKALIARALDEAELQGGTARPAARTGARKPRTGPYKHLMTGVSFMIP
FVTAGGLLIALAFAFGGIHATDAAQAHSFAGALFEIGAKSAFTLFVPVLGGYIAYSIADR
PGLAPGMIGGLLASLTGAGFLGAILAGFIGGYATRWLNEILRLPRGLQGLKPVLLLPVLG
TLFTGLLMIYVIGRPVAELLHLMTHVLRSMQGSSALALGLLLGAMMAFDMGGPVNKAAYT
FSVGLLSAQVYTPMAAVMAAGMTPPLGIALATRLFASRFNTLERESGLSTGVLGLSFITE
GAIPYAAEDPFRVIPCTMTGSAIAGAISMVADVKLRVPHGGVFVLPIPNAVTHLGLYVVA
IVAGSMLTAVMLGLVKKPAGEADG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgtcgcgatcatcgccggcggggagggcaccgtcacccgcgccctcgcg
gccgaggcgctgcgccgggcggcgcgggaggcgggacacgatatcgagatcgaggtgcgg
accggcgagggtgtgctcgatccgctcgccgcgagccggatcgctgtggcgggggtagcg
atagaggtcggcgggagtgaagcgggcgatccgcgcttcgccggaaaggcaacgatccgc
gcgacgctggccgacgtgctggcggatgccgccgccgtgctcggccgcgcggcggggacg
actccgcccggcgggcggaggatcgtcgcgatcacctcctgtccgaccggcatcgcccat
acgttcatggcggccgaggggctgttgcaggcggcgaaggcgctcggccacgagatccgc
gtcgagacccaggggtcggtcggggcgggaacgccattgacggaagacgagatcgcggcg
gcggatatcgttctgatcgccgccgatcggcaggtcgatctcgggcggttcggcggcaag
cgcgtgttccagagcggcaccaagccggcgatcaacgacggcaaggcgctgatcgcccgc
gcgctggacgaggcggaattgcagggtggcacggctcggccggcggcccgcaccggcgcg
cggaagccgaggaccgggccctacaagcacctgatgacgggcgtgtcgttcatgattccg
ttcgtcaccgcgggcgggctgctgatcgcgctggccttcgccttcggcggcattcatgcg
accgatgccgctcaggcgcacagtttcgccggcgccttgttcgagatcggtgcgaaatcg
gccttcacgctgttcgtgccggtgctcggcggttacatcgcctattcgatcgccgaccgt
ccgggcctcgcgccggggatgattggcgggctgctcgcctcgctgaccggggcggggttt
ctcggcgcgatcctggccggcttcatcggcggctatgcgacgcgctggctgaacgagatt
ctgcgcctgccgcgcggcctgcaggggctgaaaccggtgctgctgttgccggtgctcggc
acgctcttcaccgggctgctgatgatctacgtcatcggccgtccggtggccgaattgctc
cacctgatgacgcatgtcctgcgctcgatgcagggatcgagcgcgttggcgctcggcctg
cttcttggcgcgatgatggcgttcgacatgggcgggcccgtgaacaaggcggcctatacg
ttctcggtcggcctgctgtcggcgcaggtctacacgccgatggccgcggtgatggcggcg
gggatgacgccgccgctcggcatcgcgctggcgacccggctgttcgccagccggttcaac
acgctcgaacgtgagtcgggactgtcgaccggcgtgctgggcctttccttcatcaccgag
ggggcgattccctacgcggccgaggatccgttccgggtcattccctgcaccatgaccgga
tcggcgatcgccggggcgatttccatggtggccgatgtgaagctccgcgtgccgcatggc
ggggtattcgtgctgccgatcccgaacgcggtgacgcatctcgggctctatgttgtcgcc
atcgtcgccggatcgatgctgacggcggtgatgctcgggctggtcaagaagccggcgggc
gaggccgacgggtaa

DBGET integrated database retrieval system