KEGG   Acidiphilium cryptum: Acry_0189Help
Entry
Acry_0189         CDS       T00527                                 

Definition
PTS system fructose subfamily transporter subunit IIC
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
acr  Acidiphilium cryptum
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Acry_0189
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Acry_0189
Enzymes [BR:acr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     Acry_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217022..218716
Genome map
AA seq 564 aa AA seqDB search
MSDIVAIIAGGEGTVTRALAAEALRRAAREAGHDIEIEVRTGEGVLDPLAASRIAVAGVA
IEVGGSEAGDPRFAGKATIRATLADVLADAAAVLGRAAGTTPPGGRRIVAITSCPTGIAH
TFMAAEGLLQAAKALGHEIRVETQGSVGAGTPLTEDEIAAADIVLIAADRQVDLGRFGGK
RVFQSGTKPAINDGKALIARALDEAELQGGTARPAARTGARKPRTGPYKHLMTGVSFMIP
FVTAGGLLIALAFAFGGIHATDAAQAHSFAGALFEIGAKSAFTLFVPVLGGYIAYSIADR
PGLAPGMIGGLLASLTGAGFLGAILAGFIGGYATRWLNEILRLPRGLQGLKPVLLLPVLG
TLFTGLLMIYVIGRPVAELLHLMTHVLRSMQGSSALALGLLLGAMMAFDMGGPVNKAAYT
FSVGLLSAQVYTPMAAVMAAGMTPPLGIALATRLFASRFNTLERESGLSTGVLGLSFITE
GAIPYAAEDPFRVIPCTMTGSAIAGAISMVADVKLRVPHGGVFVLPIPNAVTHLGLYVVA
IVAGSMLTAVMLGLVKKPAGEADG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgtcgcgatcatcgccggcggggagggcaccgtcacccgcgccctcgcg
gccgaggcgctgcgccgggcggcgcgggaggcgggacacgatatcgagatcgaggtgcgg
accggcgagggtgtgctcgatccgctcgccgcgagccggatcgctgtggcgggggtagcg
atagaggtcggcgggagtgaagcgggcgatccgcgcttcgccggaaaggcaacgatccgc
gcgacgctggccgacgtgctggcggatgccgccgccgtgctcggccgcgcggcggggacg
actccgcccggcgggcggaggatcgtcgcgatcacctcctgtccgaccggcatcgcccat
acgttcatggcggccgaggggctgttgcaggcggcgaaggcgctcggccacgagatccgc
gtcgagacccaggggtcggtcggggcgggaacgccattgacggaagacgagatcgcggcg
gcggatatcgttctgatcgccgccgatcggcaggtcgatctcgggcggttcggcggcaag
cgcgtgttccagagcggcaccaagccggcgatcaacgacggcaaggcgctgatcgcccgc
gcgctggacgaggcggaattgcagggtggcacggctcggccggcggcccgcaccggcgcg
cggaagccgaggaccgggccctacaagcacctgatgacgggcgtgtcgttcatgattccg
ttcgtcaccgcgggcgggctgctgatcgcgctggccttcgccttcggcggcattcatgcg
accgatgccgctcaggcgcacagtttcgccggcgccttgttcgagatcggtgcgaaatcg
gccttcacgctgttcgtgccggtgctcggcggttacatcgcctattcgatcgccgaccgt
ccgggcctcgcgccggggatgattggcgggctgctcgcctcgctgaccggggcggggttt
ctcggcgcgatcctggccggcttcatcggcggctatgcgacgcgctggctgaacgagatt
ctgcgcctgccgcgcggcctgcaggggctgaaaccggtgctgctgttgccggtgctcggc
acgctcttcaccgggctgctgatgatctacgtcatcggccgtccggtggccgaattgctc
cacctgatgacgcatgtcctgcgctcgatgcagggatcgagcgcgttggcgctcggcctg
cttcttggcgcgatgatggcgttcgacatgggcgggcccgtgaacaaggcggcctatacg
ttctcggtcggcctgctgtcggcgcaggtctacacgccgatggccgcggtgatggcggcg
gggatgacgccgccgctcggcatcgcgctggcgacccggctgttcgccagccggttcaac
acgctcgaacgtgagtcgggactgtcgaccggcgtgctgggcctttccttcatcaccgag
ggggcgattccctacgcggccgaggatccgttccgggtcattccctgcaccatgaccgga
tcggcgatcgccggggcgatttccatggtggccgatgtgaagctccgcgtgccgcatggc
ggggtattcgtgctgccgatcccgaacgcggtgacgcatctcgggctctatgttgtcgcc
atcgtcgccggatcgatgctgacggcggtgatgctcgggctggtcaagaagccggcgggc
gaggccgacgggtaa

DBGET integrated database retrieval system