KEGG   Acidiphilium cryptum JF-5: Acry_0234Help
Entry
Acry_0234         CDS       T00527                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
271062..272213
Genome map
AA seq 383 aa AA seqDB search
MSPGLPDPGSARLLVVKIGSALIVDPDAAAPRTAWLASVAADIAALRARGVGVIVVSSGA
IALARRQLGLTQKRLRLEEKQAAASVGQIRLAQAWSEALSAHGLVAAQLLLTMDDTEDRR
RYLNARATLRTLLELGAVPVINENDSVATGEIRFGDNDRLAGRVAEMVEADQLVLLSDID
GLYTADPRRDPAAAHLPVVAAITPEIEAMGGAPPPGYSSGGMRTKLVAARIATQAGCAMA
IALGGVAHPLASLEAGARCTWFLPQPGGRSARKRWIAGSLAPLGRLHVDAGAARAIRRGS
SLLPAGVVRVEGRFERGDAVEIAGPDGAALARGLAAYPSEDAMLIAGHRTDEIEALLGWR
GRDELIHRDDLVLVAGPLPSVSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggggctgcccgatccaggcagcgcacggctgctggtggtgaagatcgggtcc
gccctcatcgtcgatcccgatgccgcggcgccgcgcacagcctggcttgcaagcgtggcc
gccgacatcgcggccctccgggcgcgcggcgtcggtgttatcgtggtgtcctccggggcg
atcgctctcgcgcggcggcagcttggcctgacgcagaagcggctgcggctcgaggaaaag
caggctgcggcctcggtgggtcagatccggctggcgcaggcctggagcgaggcgctttcg
gcgcacgggctggtcgcggcgcaactgttgctgaccatggacgataccgaggaccggcgg
cgctatctcaacgcgcgggccacgctccgcacgctgctcgaactcggcgccgtgcctgtg
atcaacgagaacgactcggtcgccaccggcgagatccgcttcggcgacaacgaccggctc
gccggtcgggtggccgaaatggtggaggccgaccaactggtcctgctctccgatatcgac
gggctctataccgccgatccgcggcgcgacccggcggcggcgcatctacccgtcgtcgcc
gcgatcacgccggagatcgaggcgatgggcggcgcgccgccgccgggctattcctccggc
gggatgcggaccaagctcgtcgccgcgcggatcgcgacccaggccggctgtgccatggcg
atcgcgcttggcggggttgcgcatccgctcgcgtccctcgaagcgggggcgcgctgcacc
tggttcctgccgcagcccggagggcgctcggcgcgcaagcgctggatcgccggctcgctc
gcgccgctcgggcggctgcatgtcgatgccggcgcggcgcgggcgatccgccgcggctca
tcgctgctgccggcgggggtggtgcgcgtcgagggacggttcgagcgtggcgatgcggtc
gagatcgccgggccggatggggcggcgctggcccgcggccttgccgcctatccgagcgag
gatgcgatgctcatcgccggccacaggaccgacgagatcgaggcgctgctcggctggcgc
ggtcgggatgagctgatccaccgcgacgacctcgtgctcgtcgccggcccgttgccgtcc
gtttcgtcgtag

DBGET integrated database retrieval system