KEGG   Acidiphilium cryptum: Acry_0265Help
Entry
Acry_0265         CDS       T00527                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
acr  Acidiphilium cryptum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acry_0265
Enzymes [BR:acr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Acry_0265
Peptidases [BR:acr01002]
 Cysteine Peptidases
  Family C44
   Acry_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
304864..306609
Genome map
AA seq 581 aa AA seqDB search
MCGIAGLALKPGARIAPETLAALARALAHRGPDGAGTHVSERAALVHTRLAIVDLATGDQ
PLFGAGAALIGNGEIYNNRELRAALPLVPFRTGSDCEPPLHLARAEADFVPLLRGMYALA
IDDSERGVVTLARDPFGIKPLYRCAADQGTAFASEPQALLAAGLARRRIDTARLVELLQL
QFTAGTATVFTGIERVPPGALLTLRDGAEAALLDHPPIEPGEAPRDEDAALVALDAVLAQ
SVELHQRSDVPYGMFLSGGIDSAAILALMARLNETPVLAFTAGFDRATVADERDDAEATA
RAVGARHERIEITEAMTWRYLPAIVAAMDDPAADYAIIPTWFLARHARGSVKVVLSGEGG
DEMFAGYGRYRAAARPWPFARPMRARGAFDGLDLLRDRGEGWRAGLLRARQAAGGSGLAR
AQREDVATWLPDDLLLKLDRCLMAHGVEGRTPFLDREVARFAFALPDRLRARRGLGKYLL
RKWLEANLPAARPFARKQGFDVPVAAWIAGQGQRLGELVSRAPVIAEVADPARVRDLFGR
ATDRRAGVACWRLLFLALWHHRHGLGGAVDGDVFEILGERA
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccggactcgcgctgaagccgggggcgcggatcgcgccggaaaccctc
gcggcgctcgcccgcgcgctggcccatcgcgggccggatggtgcgggcacccatgtcagc
gagcgcgcggcgctggtgcatacccgcctcgccattgtcgatctcgcgaccggcgaccag
ccgctgttcggtgccggtgccgcgctgatcggcaatggcgagatctacaacaaccgcgaa
ttgcgcgccgccctgccgcttgtgcccttccgcaccggcagcgattgcgagccgccgctg
catcttgcccgcgccgaggcggatttcgtgcctctgctgcgcgggatgtatgcgctcgcg
atcgatgattccgagcgcggcgtggtgacgctggcgcgcgatccgttcggaatcaagccg
ctctaccgctgcgccgccgaccagggcaccgccttcgcctccgagccgcaggcgctgctc
gccgccgggctcgcgaggcggcggatcgacacggcgcgcctcgtcgagctgctgcaactg
caattcaccgccggcaccgcaaccgtcttcaccgggatcgagcgggtgccgcccggcgcg
ctgctcaccctgcgcgatggcgccgaggcggcactgctcgaccatccgccgatcgagccg
ggcgaggcgccgcgcgatgaggatgcggccctcgtcgcgctcgatgccgtgctggcgcaa
tcggtcgagctccaccagcgcagcgatgtgccgtatggcatgttcctctcgggcgggatc
gacagcgccgcgatcctcgccctgatggcgcggctgaacgagacgccggtgctcgccttc
accgccgggttcgaccgcgccacggtggccgacgagcgcgacgatgccgaggcgaccgcc
cgcgccgtcggcgcccggcacgagcggatcgagatcaccgaggcgatgacctggcggtac
ctgcccgccatcgtcgccgcgatggacgacccggccgccgattatgcgatcatccccaca
tggttcctcgcccgccacgcgcgcgggagcgtcaaggtcgtgctgtccggcgagggcggg
gacgagatgttcgccggctacggccgctatcgcgcggcggcgcggccctggcccttcgcc
cggccgatgcgcgcccgcggcgcgttcgacgggctcgacctgctgcgcgatcgcggcgaa
ggctggcgcgccggcctcctgcgggcgcggcaggcggcaggcggcagcggcctcgcccgc
gcgcagcgcgaggatgtggcgacctggctgcccgacgatctgctgctcaagctcgatcgc
tgcctcatggcgcatggcgtcgagggccgcacgcccttcctcgaccgcgaggtggcgcgc
ttcgccttcgccctgccggaccggctgcgggcgcgccgggggcttggcaaatatctgctg
cgcaaatggctggaggcgaacctgccggcggcgcgtcccttcgcccgcaagcaggggttc
gacgtgccggtcgccgcctggatcgccgggcagggccagcgcctcggcgagctagtgtcg
cgcgcgccggtcatcgccgaggtggcagatccggcgcgggtgcgcgacctgttcggccgc
gcgaccgaccgccgggccggcgtggcatgctggcggctgctgttcctcgccctgtggcat
catcgccacgggctgggcggcgccgtcgatggcgatgtgttcgaaatactgggagaacgg
gcatga

DBGET integrated database retrieval system