KEGG   Acidiphilium cryptum JF-5: Acry_0274Help
Entry
Acry_0274         CDS       T00527                                 

Definition
succinate-semialdehyde dehydrogenase
Orthology
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
acr  Acidiphilium cryptum JF-5
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:acr00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:acr00250]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:acr00310]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:acr00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
314881..316359
Genome map
AA seq 492 aa AA seqDB search
MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGELVGRVPAMGAAETRRA
IEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAEQGKPLAEAKGEIAYAA
GFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPWNFPSAMITRKAGPGWAA
GCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGPMGAELTANPIVRKFSFTG
STEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAVKGAIDSKFRNAGQTCVCAN
RILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLINREAVEKVEAHIADAVAGGAR
IVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVAPLFRFNTEAEAIAMANDTEFG
LASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAPFGGVKSSGLGREGSKYGIEDYL
EIKYLALGGLGG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacaccaccggaacggtacggctgaaagacccggcgctgctgcgggaagccaat
tacatcaacggagaatgggtgcaggcggagagcgggaagaccctcgacgtcctgaatcca
gcgacgggcgaactcgttggccgggtgccggcgatgggcgccgcggaaacgcgccgcgcg
atcgaggcggccggccgcgccctggccggctggcgggcgatgctggcgaaggagcgcgct
gcgatcctccgccgcctctacgagttgatgatggccaaccaggacgatctcggcgcgatc
atgacggccgagcagggcaagccgctggccgaggcgaagggcgagatcgcctacgccgcc
ggcttcatcgagtggttcgccgaggagggcaagcggatctacggcgacaccatcccgcag
aacgcccccggccggcggatcatcgtgcagaaacagccgatcggcgtcttcgcggcggtc
accccgtggaacttcccctcggcgatgatcacccgcaaggccggtccgggctgggcggcg
ggctgcaccggggtgatccgcccggcgagccagaccccgttctccgcccttgccctcgcc
gtccttgccgagcgcgccggcatgccggcgggcgtgtgcaacatcatcaccggcccctcc
ggcccgatgggtgctgaactcaccgccaacccgatcgtgcggaaattctccttcaccggc
agcaccgaggtcggcgcgaagctgctcgcccagtgcgcgccgaccatcaagaagacgtcg
atggaacttggcggcaacgcccccttcatcgtcttcgacgacgccgatctcgacgccgcg
gtgaagggggcgatcgattcgaaattccgcaatgccgggcagacctgcgtctgcgccaac
cgcatcctcgttcaggacggtgtgttcgagctctttgccgaaaagctgaaggtcgcggtc
gaggcgctgaaggtcggcaacggcatggagcctggcgtcacccaggggccgctgatcaac
cgcgaggcggtggagaaggtggaggcgcatatcgccgacgcggtggccggcggtgcccga
atcgtcaccggcggcacgcgccacgagcggggcggcaatttcttcacgccgaccgtcatc
gccgacgtgaagcatgacgcgctgatcttccgcgaggaaaccttcggcccggtcgccccg
ctgttccgcttcaacaccgaggcggaggcgatcgcgatggcgaatgataccgaattcggc
ctcgccagctatttctacgcccgcgatgtcggccgcatcttccgcgttgccgaggcgctg
gaatacggcatcgtcggcatcaacgagggcctgatctcgaccgaagtcgcccccttcggc
ggcgtcaaatcctccggcctcggccgcgagggatcgaaatacgggatcgaggattatctc
gagatcaagtatctggcgctcggcggcctgggcggctaa

DBGET integrated database retrieval system