KEGG   Acidiphilium cryptum: Acry_0274Help
Entry
Acry_0274         CDS       T00527                                 

Definition
(GenBank) succinate semialdehyde dehydrogenase (EC:1.2.1.16)
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
acr  Acidiphilium cryptum
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Acry_0274
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acry_0274
   00310 Lysine degradation
    Acry_0274
   00350 Tyrosine metabolism
    Acry_0274
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Acry_0274
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Acry_0274
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Acry_0274
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Acry_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
314881..316359
Genome map
AA seq 492 aa AA seqDB search
MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGELVGRVPAMGAAETRRA
IEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAEQGKPLAEAKGEIAYAA
GFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPWNFPSAMITRKAGPGWAA
GCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGPMGAELTANPIVRKFSFTG
STEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAVKGAIDSKFRNAGQTCVCAN
RILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLINREAVEKVEAHIADAVAGGAR
IVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVAPLFRFNTEAEAIAMANDTEFG
LASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAPFGGVKSSGLGREGSKYGIEDYL
EIKYLALGGLGG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacaccaccggaacggtacggctgaaagacccggcgctgctgcgggaagccaat
tacatcaacggagaatgggtgcaggcggagagcgggaagaccctcgacgtcctgaatcca
gcgacgggcgaactcgttggccgggtgccggcgatgggcgccgcggaaacgcgccgcgcg
atcgaggcggccggccgcgccctggccggctggcgggcgatgctggcgaaggagcgcgct
gcgatcctccgccgcctctacgagttgatgatggccaaccaggacgatctcggcgcgatc
atgacggccgagcagggcaagccgctggccgaggcgaagggcgagatcgcctacgccgcc
ggcttcatcgagtggttcgccgaggagggcaagcggatctacggcgacaccatcccgcag
aacgcccccggccggcggatcatcgtgcagaaacagccgatcggcgtcttcgcggcggtc
accccgtggaacttcccctcggcgatgatcacccgcaaggccggtccgggctgggcggcg
ggctgcaccggggtgatccgcccggcgagccagaccccgttctccgcccttgccctcgcc
gtccttgccgagcgcgccggcatgccggcgggcgtgtgcaacatcatcaccggcccctcc
ggcccgatgggtgctgaactcaccgccaacccgatcgtgcggaaattctccttcaccggc
agcaccgaggtcggcgcgaagctgctcgcccagtgcgcgccgaccatcaagaagacgtcg
atggaacttggcggcaacgcccccttcatcgtcttcgacgacgccgatctcgacgccgcg
gtgaagggggcgatcgattcgaaattccgcaatgccgggcagacctgcgtctgcgccaac
cgcatcctcgttcaggacggtgtgttcgagctctttgccgaaaagctgaaggtcgcggtc
gaggcgctgaaggtcggcaacggcatggagcctggcgtcacccaggggccgctgatcaac
cgcgaggcggtggagaaggtggaggcgcatatcgccgacgcggtggccggcggtgcccga
atcgtcaccggcggcacgcgccacgagcggggcggcaatttcttcacgccgaccgtcatc
gccgacgtgaagcatgacgcgctgatcttccgcgaggaaaccttcggcccggtcgccccg
ctgttccgcttcaacaccgaggcggaggcgatcgcgatggcgaatgataccgaattcggc
ctcgccagctatttctacgcccgcgatgtcggccgcatcttccgcgttgccgaggcgctg
gaatacggcatcgtcggcatcaacgagggcctgatctcgaccgaagtcgcccccttcggc
ggcgtcaaatcctccggcctcggccgcgagggatcgaaatacgggatcgaggattatctc
gagatcaagtatctggcgctcggcggcctgggcggctaa

DBGET integrated database retrieval system