KEGG   Acidiphilium cryptum: Acry_0274Help
Entry
Acry_0274         CDS       T00527                                 

Definition
succinate-semialdehyde dehydrogenase
Orthology
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
acr  Acidiphilium cryptum
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Acry_0274
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acry_0274
   00310 Lysine degradation
    Acry_0274
   00350 Tyrosine metabolism
    Acry_0274
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Acry_0274
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Acry_0274
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Acry_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
314881..316359
Genome map
AA seq 492 aa AA seqDB search
MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGELVGRVPAMGAAETRRA
IEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAEQGKPLAEAKGEIAYAA
GFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPWNFPSAMITRKAGPGWAA
GCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGPMGAELTANPIVRKFSFTG
STEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAVKGAIDSKFRNAGQTCVCAN
RILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLINREAVEKVEAHIADAVAGGAR
IVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVAPLFRFNTEAEAIAMANDTEFG
LASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAPFGGVKSSGLGREGSKYGIEDYL
EIKYLALGGLGG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacaccaccggaacggtacggctgaaagacccggcgctgctgcgggaagccaat
tacatcaacggagaatgggtgcaggcggagagcgggaagaccctcgacgtcctgaatcca
gcgacgggcgaactcgttggccgggtgccggcgatgggcgccgcggaaacgcgccgcgcg
atcgaggcggccggccgcgccctggccggctggcgggcgatgctggcgaaggagcgcgct
gcgatcctccgccgcctctacgagttgatgatggccaaccaggacgatctcggcgcgatc
atgacggccgagcagggcaagccgctggccgaggcgaagggcgagatcgcctacgccgcc
ggcttcatcgagtggttcgccgaggagggcaagcggatctacggcgacaccatcccgcag
aacgcccccggccggcggatcatcgtgcagaaacagccgatcggcgtcttcgcggcggtc
accccgtggaacttcccctcggcgatgatcacccgcaaggccggtccgggctgggcggcg
ggctgcaccggggtgatccgcccggcgagccagaccccgttctccgcccttgccctcgcc
gtccttgccgagcgcgccggcatgccggcgggcgtgtgcaacatcatcaccggcccctcc
ggcccgatgggtgctgaactcaccgccaacccgatcgtgcggaaattctccttcaccggc
agcaccgaggtcggcgcgaagctgctcgcccagtgcgcgccgaccatcaagaagacgtcg
atggaacttggcggcaacgcccccttcatcgtcttcgacgacgccgatctcgacgccgcg
gtgaagggggcgatcgattcgaaattccgcaatgccgggcagacctgcgtctgcgccaac
cgcatcctcgttcaggacggtgtgttcgagctctttgccgaaaagctgaaggtcgcggtc
gaggcgctgaaggtcggcaacggcatggagcctggcgtcacccaggggccgctgatcaac
cgcgaggcggtggagaaggtggaggcgcatatcgccgacgcggtggccggcggtgcccga
atcgtcaccggcggcacgcgccacgagcggggcggcaatttcttcacgccgaccgtcatc
gccgacgtgaagcatgacgcgctgatcttccgcgaggaaaccttcggcccggtcgccccg
ctgttccgcttcaacaccgaggcggaggcgatcgcgatggcgaatgataccgaattcggc
ctcgccagctatttctacgcccgcgatgtcggccgcatcttccgcgttgccgaggcgctg
gaatacggcatcgtcggcatcaacgagggcctgatctcgaccgaagtcgcccccttcggc
ggcgtcaaatcctccggcctcggccgcgagggatcgaaatacgggatcgaggattatctc
gagatcaagtatctggcgctcggcggcctgggcggctaa

DBGET integrated database retrieval system